Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0F9YM01

Protein Details
Accession A0A0F9YM01    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MVINTLKSKRKRNTSKTMLKNQFTAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, mito_nucl 12.666, cyto_nucl 12.333, mito 4.5
Family & Domain DBs
Amino Acid Sequences MVINTLKSKRKRNTSKTMLKNQFTASKRELYKKYKNSESNFRMLFKLVIKNRMPQFIKKLEISNLSDDLKQKSILALRNLSSFLDTVSAIRINLNKKKNKEYFFYSLNLACNQCRRSAGAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.89
3 0.89
4 0.91
5 0.89
6 0.8
7 0.74
8 0.67
9 0.65
10 0.56
11 0.52
12 0.45
13 0.43
14 0.44
15 0.49
16 0.54
17 0.54
18 0.62
19 0.64
20 0.69
21 0.7
22 0.74
23 0.72
24 0.74
25 0.7
26 0.67
27 0.6
28 0.54
29 0.45
30 0.38
31 0.34
32 0.26
33 0.3
34 0.26
35 0.31
36 0.31
37 0.37
38 0.38
39 0.44
40 0.43
41 0.38
42 0.41
43 0.38
44 0.39
45 0.34
46 0.34
47 0.28
48 0.3
49 0.28
50 0.24
51 0.22
52 0.2
53 0.2
54 0.2
55 0.2
56 0.18
57 0.16
58 0.14
59 0.14
60 0.17
61 0.2
62 0.21
63 0.22
64 0.22
65 0.22
66 0.23
67 0.21
68 0.18
69 0.13
70 0.1
71 0.09
72 0.08
73 0.07
74 0.09
75 0.09
76 0.08
77 0.1
78 0.14
79 0.21
80 0.29
81 0.37
82 0.43
83 0.49
84 0.59
85 0.65
86 0.66
87 0.65
88 0.65
89 0.62
90 0.57
91 0.54
92 0.47
93 0.42
94 0.4
95 0.38
96 0.32
97 0.29
98 0.34
99 0.33
100 0.32
101 0.32