Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F9WP54

Protein Details
Accession A0A0F9WP54    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MPVKRKNHGKNRKNRGSCKPVQCDKCHydrophilic
NLS Segment(s)
PositionSequence
5-13RKNHGKNRK
Subcellular Location(s) nucl 16.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
Amino Acid Sequences MPVKRKNHGKNRKNRGSCKPVQCDKCGRLVPKDKAIKRFKIVPLVEAGSMDDVKVASIYDVFEVPRISYKNQYCVSCACHARIVRVRSRQGRKIRYDGEKRMVK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.89
3 0.88
4 0.87
5 0.86
6 0.85
7 0.83
8 0.78
9 0.76
10 0.74
11 0.66
12 0.65
13 0.61
14 0.54
15 0.54
16 0.58
17 0.57
18 0.57
19 0.64
20 0.61
21 0.65
22 0.69
23 0.65
24 0.59
25 0.62
26 0.55
27 0.55
28 0.5
29 0.41
30 0.37
31 0.33
32 0.29
33 0.21
34 0.19
35 0.1
36 0.1
37 0.08
38 0.06
39 0.04
40 0.04
41 0.04
42 0.04
43 0.03
44 0.03
45 0.04
46 0.04
47 0.05
48 0.05
49 0.06
50 0.07
51 0.07
52 0.11
53 0.12
54 0.14
55 0.22
56 0.24
57 0.3
58 0.35
59 0.35
60 0.33
61 0.34
62 0.36
63 0.35
64 0.35
65 0.29
66 0.31
67 0.3
68 0.36
69 0.41
70 0.43
71 0.44
72 0.51
73 0.58
74 0.62
75 0.7
76 0.72
77 0.75
78 0.79
79 0.78
80 0.79
81 0.78
82 0.79
83 0.8
84 0.79