Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F9WGH4

Protein Details
Accession A0A0F9WGH4    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
12-36ANFKETFKVKKKPIEIRKSQQQDNNHydrophilic
116-136DRKACRMKYHAECKNNKNRINHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto_nucl 14, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR001005  SANT/Myb  
IPR039467  TFIIIB_B''_Myb  
Gene Ontology GO:0003743  F:translation initiation factor activity  
Pfam View protein in Pfam  
PF15963  Myb_DNA-bind_7  
CDD cd00167  SANT  
Amino Acid Sequences MDKKLSFYLDNANFKETFKVKKKPIEIRKSQQQDNNLLKIVNGEICIDANDMFVNLNKDVDMEVLEETGIVTSATYLTKKRRNNRWTKQETEYFYEALSLCGLEFTLISDLFLNKDRKACRMKYHAECKNNKNRINVALNKKETFCPHRYEELKIKIKEKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.44
3 0.38
4 0.39
5 0.41
6 0.49
7 0.53
8 0.61
9 0.69
10 0.73
11 0.8
12 0.81
13 0.82
14 0.82
15 0.85
16 0.83
17 0.81
18 0.75
19 0.7
20 0.69
21 0.65
22 0.6
23 0.5
24 0.43
25 0.36
26 0.32
27 0.27
28 0.18
29 0.13
30 0.1
31 0.09
32 0.09
33 0.1
34 0.09
35 0.08
36 0.07
37 0.06
38 0.06
39 0.06
40 0.07
41 0.09
42 0.08
43 0.08
44 0.08
45 0.08
46 0.08
47 0.08
48 0.07
49 0.06
50 0.06
51 0.05
52 0.05
53 0.05
54 0.05
55 0.04
56 0.04
57 0.03
58 0.02
59 0.02
60 0.03
61 0.04
62 0.05
63 0.08
64 0.15
65 0.23
66 0.3
67 0.38
68 0.48
69 0.58
70 0.68
71 0.75
72 0.8
73 0.79
74 0.78
75 0.75
76 0.7
77 0.64
78 0.58
79 0.49
80 0.39
81 0.32
82 0.28
83 0.23
84 0.17
85 0.13
86 0.08
87 0.06
88 0.05
89 0.05
90 0.04
91 0.03
92 0.04
93 0.06
94 0.05
95 0.06
96 0.07
97 0.07
98 0.08
99 0.15
100 0.16
101 0.16
102 0.22
103 0.24
104 0.3
105 0.38
106 0.41
107 0.43
108 0.5
109 0.57
110 0.61
111 0.7
112 0.72
113 0.74
114 0.78
115 0.79
116 0.81
117 0.81
118 0.77
119 0.72
120 0.68
121 0.66
122 0.67
123 0.67
124 0.66
125 0.66
126 0.66
127 0.63
128 0.6
129 0.57
130 0.56
131 0.54
132 0.49
133 0.45
134 0.46
135 0.53
136 0.53
137 0.56
138 0.58
139 0.61
140 0.66
141 0.65