Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0F9WFZ8

Protein Details
Accession A0A0F9WFZ8    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
130-157VKSFLKAEVKQDKKRKNVKSLENIKNVTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 14.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012173  Mpp10  
Gene Ontology GO:0034457  C:Mpp10 complex  
GO:0005732  C:sno(s)RNA-containing ribonucleoprotein complex  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF04006  Mpp10  
Amino Acid Sequences MSKNSTHKNLSDIEKELIKTKDWRYKGEVDKFKRPVNSLLTEKDINYDVAEKLEPISNKQNIEIMKMTLQRLREGTFDNYDFTVTQIEEEELEYNEEENKDVVELYNEIESDLLKISDFGSFGFMPDTEVKSFLKAEVKQDKKRKNVKSLENIKNVTVLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.38
3 0.4
4 0.35
5 0.32
6 0.34
7 0.39
8 0.45
9 0.45
10 0.48
11 0.49
12 0.56
13 0.62
14 0.66
15 0.67
16 0.65
17 0.72
18 0.72
19 0.71
20 0.65
21 0.59
22 0.54
23 0.51
24 0.5
25 0.44
26 0.42
27 0.42
28 0.39
29 0.36
30 0.32
31 0.27
32 0.21
33 0.17
34 0.16
35 0.12
36 0.12
37 0.12
38 0.1
39 0.1
40 0.13
41 0.12
42 0.14
43 0.21
44 0.23
45 0.24
46 0.24
47 0.26
48 0.23
49 0.26
50 0.24
51 0.17
52 0.18
53 0.2
54 0.2
55 0.19
56 0.2
57 0.18
58 0.18
59 0.18
60 0.16
61 0.17
62 0.18
63 0.19
64 0.18
65 0.17
66 0.16
67 0.15
68 0.14
69 0.11
70 0.1
71 0.07
72 0.07
73 0.06
74 0.06
75 0.06
76 0.06
77 0.07
78 0.06
79 0.07
80 0.07
81 0.06
82 0.08
83 0.08
84 0.08
85 0.07
86 0.06
87 0.06
88 0.06
89 0.06
90 0.06
91 0.06
92 0.07
93 0.07
94 0.07
95 0.07
96 0.07
97 0.07
98 0.07
99 0.07
100 0.06
101 0.05
102 0.05
103 0.06
104 0.07
105 0.07
106 0.06
107 0.1
108 0.09
109 0.1
110 0.11
111 0.1
112 0.12
113 0.15
114 0.17
115 0.14
116 0.16
117 0.16
118 0.17
119 0.18
120 0.18
121 0.23
122 0.22
123 0.31
124 0.4
125 0.48
126 0.56
127 0.66
128 0.72
129 0.75
130 0.83
131 0.83
132 0.83
133 0.84
134 0.84
135 0.85
136 0.87
137 0.87
138 0.85
139 0.78
140 0.68