Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0F9WDI8

Protein Details
Accession A0A0F9WDI8    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
57-78ENKHKLITKIKIPKKNKNNLNKHydrophilic
NLS Segment(s)
PositionSequence
61-74KLITKIKIPKKNKN
Subcellular Location(s) nucl 18.5, cyto_nucl 12, cyto 4.5, mito 4
Family & Domain DBs
Amino Acid Sequences MKLYDLFFNTLATTNDFELAIKAVENEILKRKTCLPLQNSDTYQDLKINLEKIIKLENKHKLITKIKIPKKNKNNLNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.15
4 0.13
5 0.12
6 0.11
7 0.09
8 0.07
9 0.07
10 0.06
11 0.08
12 0.09
13 0.11
14 0.17
15 0.19
16 0.2
17 0.21
18 0.24
19 0.26
20 0.3
21 0.35
22 0.31
23 0.36
24 0.4
25 0.43
26 0.41
27 0.37
28 0.35
29 0.29
30 0.26
31 0.2
32 0.16
33 0.14
34 0.15
35 0.14
36 0.15
37 0.15
38 0.15
39 0.15
40 0.22
41 0.23
42 0.25
43 0.32
44 0.39
45 0.41
46 0.44
47 0.48
48 0.49
49 0.53
50 0.57
51 0.59
52 0.6
53 0.66
54 0.73
55 0.77
56 0.8
57 0.82
58 0.86