Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F9Z7J0

Protein Details
Accession A0A0F9Z7J0   
Localization Confidence Medium
Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
10-32DDKSKIKYCKIEKRKITTEKGKEBasic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto_nucl 12, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR043502  DNA/RNA_pol_sf  
Amino Acid Sequences MKEFLEVLTDDKSKIKYCKIEKRKITTEKGKEVFKKGQMIPQALIKYTVKHLENLEESGIIRKSSSTWRNTVRALRKPNGSIRLVSNLML
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.34
3 0.39
4 0.48
5 0.58
6 0.65
7 0.73
8 0.76
9 0.8
10 0.83
11 0.82
12 0.81
13 0.8
14 0.77
15 0.77
16 0.72
17 0.7
18 0.64
19 0.62
20 0.58
21 0.52
22 0.52
23 0.43
24 0.43
25 0.4
26 0.38
27 0.33
28 0.31
29 0.28
30 0.21
31 0.23
32 0.19
33 0.16
34 0.16
35 0.2
36 0.16
37 0.17
38 0.18
39 0.19
40 0.2
41 0.2
42 0.18
43 0.14
44 0.13
45 0.15
46 0.15
47 0.11
48 0.1
49 0.09
50 0.11
51 0.2
52 0.26
53 0.27
54 0.33
55 0.39
56 0.43
57 0.48
58 0.55
59 0.55
60 0.57
61 0.62
62 0.61
63 0.61
64 0.63
65 0.66
66 0.65
67 0.58
68 0.52
69 0.47
70 0.48