Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0F9Z6J9

Protein Details
Accession A0A0F9Z6J9    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
13-33LKNANKITSKKGRKRALSFRTHydrophilic
NLS Segment(s)
PositionSequence
21-28SKKGRKRA
Subcellular Location(s) nucl 19, cyto_nucl 11.5, mito 6
Family & Domain DBs
Amino Acid Sequences DRSMTAIRNYPTLKNANKITSKKGRKRALSFRTVKKIQSMGSDKAITISKIKADLNLPVSKSNVLRSDKENNNLIYKKRDRNRI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.46
3 0.47
4 0.52
5 0.53
6 0.56
7 0.59
8 0.66
9 0.69
10 0.74
11 0.75
12 0.75
13 0.8
14 0.82
15 0.79
16 0.78
17 0.77
18 0.75
19 0.75
20 0.69
21 0.61
22 0.54
23 0.48
24 0.4
25 0.39
26 0.36
27 0.3
28 0.3
29 0.3
30 0.26
31 0.25
32 0.25
33 0.18
34 0.14
35 0.13
36 0.11
37 0.13
38 0.13
39 0.13
40 0.14
41 0.17
42 0.2
43 0.22
44 0.23
45 0.22
46 0.23
47 0.23
48 0.23
49 0.24
50 0.27
51 0.28
52 0.29
53 0.33
54 0.42
55 0.45
56 0.49
57 0.5
58 0.46
59 0.5
60 0.52
61 0.51
62 0.52
63 0.55
64 0.6