Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0F9WBA6

Protein Details
Accession A0A0F9WBA6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MYHIYFPKRKRFRPTLYFPFSIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, plas 5, golg 5, cyto_mito 5, mito_nucl 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MYHIYFPKRKRFRPTLYFPFSIIAFFYKKLCITCLLLFILPKIAEIVILAFFKSQNLAFLNITWCFYLPILRYKKYNLEKRKYLHVLIKFVVRPENNNSRGTSKIV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.84
3 0.81
4 0.75
5 0.65
6 0.57
7 0.47
8 0.37
9 0.28
10 0.2
11 0.14
12 0.14
13 0.14
14 0.14
15 0.16
16 0.16
17 0.16
18 0.16
19 0.18
20 0.18
21 0.19
22 0.18
23 0.17
24 0.17
25 0.16
26 0.15
27 0.11
28 0.11
29 0.09
30 0.07
31 0.06
32 0.06
33 0.07
34 0.05
35 0.06
36 0.05
37 0.05
38 0.05
39 0.05
40 0.06
41 0.06
42 0.06
43 0.07
44 0.1
45 0.1
46 0.1
47 0.13
48 0.12
49 0.13
50 0.11
51 0.1
52 0.09
53 0.09
54 0.12
55 0.11
56 0.2
57 0.24
58 0.26
59 0.27
60 0.3
61 0.4
62 0.46
63 0.54
64 0.56
65 0.6
66 0.66
67 0.67
68 0.74
69 0.69
70 0.65
71 0.62
72 0.58
73 0.54
74 0.48
75 0.51
76 0.42
77 0.39
78 0.42
79 0.35
80 0.34
81 0.38
82 0.46
83 0.43
84 0.45
85 0.46
86 0.42