Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F9WBF0

Protein Details
Accession A0A0F9WBF0    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
48-70DELKKILKKKDIKRKKSLEVFCNHydrophilic
NLS Segment(s)
PositionSequence
51-63KKILKKKDIKRKK
Subcellular Location(s) cyto_nucl 13.5, cyto 12.5, nucl 11.5
Family & Domain DBs
Amino Acid Sequences MDNSNRTGYVDFKTNINGTDTDIKILETLTHVFIYVNQAEEQVNLFDDELKKILKKKDIKRKKSLEVFCNLKSRDNLNDISVFLHKLFIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.26
3 0.25
4 0.23
5 0.2
6 0.26
7 0.25
8 0.22
9 0.21
10 0.2
11 0.18
12 0.17
13 0.14
14 0.08
15 0.09
16 0.09
17 0.09
18 0.09
19 0.09
20 0.09
21 0.13
22 0.11
23 0.12
24 0.1
25 0.11
26 0.11
27 0.11
28 0.11
29 0.07
30 0.07
31 0.06
32 0.06
33 0.07
34 0.07
35 0.08
36 0.08
37 0.09
38 0.1
39 0.15
40 0.2
41 0.26
42 0.35
43 0.44
44 0.55
45 0.65
46 0.72
47 0.78
48 0.82
49 0.83
50 0.84
51 0.82
52 0.76
53 0.74
54 0.71
55 0.65
56 0.65
57 0.56
58 0.51
59 0.46
60 0.43
61 0.41
62 0.39
63 0.37
64 0.31
65 0.32
66 0.28
67 0.28
68 0.26
69 0.22
70 0.18