Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q5KNG7

Protein Details
Accession Q5KNG7   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
68-88SNTARNRPGFPRKQRTNDVEDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 11, cyto 3.5, mito 3, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR015947  PUA-like_sf  
IPR036987  SRA-YDG_sf  
IPR003105  SRA_YDG  
IPR045134  UHRF1/2-like  
Gene Ontology GO:0005634  C:nucleus  
GO:0061630  F:ubiquitin protein ligase activity  
GO:0044027  P:negative regulation of gene expression via CpG island methylation  
GO:0016567  P:protein ubiquitination  
Pfam View protein in Pfam  
PF02182  SAD_SRA  
PROSITE View protein in PROSITE  
PS51015  YDG  
Amino Acid Sequences MTDTEKSQLSLMNLTYEEQRLENIRKNEELLRSLGLETPSEAKSLATPSSLKTAGKQRRYDDGLAGESNTARNRPGFPRKQRTNDVEDLTLVPHSAVKRRRSVRLGGREKPNYTKELVTFNGDRDTPNTPSRYIKSTHSHPDSEEGDIRQGKISKLGVRLHNPKTFGHIPGVEVGKWWATRMEASADAVHAPTVAGISGNANDGAWSVALSGGYPDDIDLGYAFTYTGCGGRDLKGTKQNPKNLRTAPQTSHQSFDNPLNAALKRSAETRNPVRVIRGFKLQSKYAPPTGYRYDGLYVVEKAWMAKGLTNGLMVCRYAFKRMDDQEPLPERDLDHDDDNDKARPSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.23
3 0.21
4 0.21
5 0.17
6 0.19
7 0.23
8 0.28
9 0.35
10 0.37
11 0.4
12 0.4
13 0.44
14 0.47
15 0.45
16 0.42
17 0.36
18 0.32
19 0.29
20 0.28
21 0.28
22 0.23
23 0.19
24 0.18
25 0.19
26 0.18
27 0.17
28 0.16
29 0.13
30 0.14
31 0.17
32 0.16
33 0.15
34 0.15
35 0.16
36 0.22
37 0.24
38 0.22
39 0.25
40 0.34
41 0.41
42 0.49
43 0.54
44 0.52
45 0.58
46 0.63
47 0.6
48 0.54
49 0.48
50 0.42
51 0.37
52 0.33
53 0.26
54 0.21
55 0.22
56 0.19
57 0.16
58 0.15
59 0.16
60 0.2
61 0.28
62 0.39
63 0.46
64 0.55
65 0.65
66 0.73
67 0.79
68 0.83
69 0.8
70 0.77
71 0.74
72 0.66
73 0.56
74 0.48
75 0.4
76 0.32
77 0.26
78 0.18
79 0.11
80 0.11
81 0.11
82 0.17
83 0.24
84 0.28
85 0.38
86 0.43
87 0.5
88 0.52
89 0.59
90 0.62
91 0.66
92 0.69
93 0.68
94 0.72
95 0.7
96 0.69
97 0.67
98 0.6
99 0.51
100 0.45
101 0.4
102 0.33
103 0.32
104 0.3
105 0.28
106 0.25
107 0.24
108 0.24
109 0.22
110 0.2
111 0.18
112 0.21
113 0.2
114 0.24
115 0.24
116 0.24
117 0.28
118 0.29
119 0.3
120 0.29
121 0.31
122 0.32
123 0.36
124 0.43
125 0.43
126 0.42
127 0.39
128 0.42
129 0.37
130 0.34
131 0.3
132 0.21
133 0.21
134 0.21
135 0.21
136 0.18
137 0.18
138 0.16
139 0.17
140 0.19
141 0.18
142 0.23
143 0.28
144 0.29
145 0.35
146 0.43
147 0.45
148 0.45
149 0.44
150 0.38
151 0.4
152 0.38
153 0.32
154 0.27
155 0.22
156 0.19
157 0.21
158 0.21
159 0.15
160 0.13
161 0.12
162 0.11
163 0.1
164 0.1
165 0.07
166 0.07
167 0.07
168 0.08
169 0.09
170 0.08
171 0.09
172 0.09
173 0.09
174 0.09
175 0.08
176 0.07
177 0.05
178 0.05
179 0.04
180 0.03
181 0.03
182 0.03
183 0.03
184 0.04
185 0.04
186 0.05
187 0.05
188 0.04
189 0.04
190 0.05
191 0.05
192 0.04
193 0.04
194 0.03
195 0.04
196 0.04
197 0.04
198 0.04
199 0.04
200 0.04
201 0.04
202 0.04
203 0.04
204 0.04
205 0.04
206 0.04
207 0.04
208 0.04
209 0.04
210 0.04
211 0.04
212 0.04
213 0.05
214 0.06
215 0.06
216 0.08
217 0.09
218 0.11
219 0.16
220 0.18
221 0.23
222 0.31
223 0.35
224 0.43
225 0.5
226 0.57
227 0.6
228 0.62
229 0.65
230 0.6
231 0.63
232 0.6
233 0.58
234 0.53
235 0.53
236 0.57
237 0.51
238 0.49
239 0.42
240 0.37
241 0.34
242 0.34
243 0.3
244 0.22
245 0.22
246 0.24
247 0.23
248 0.23
249 0.22
250 0.19
251 0.17
252 0.19
253 0.23
254 0.24
255 0.32
256 0.38
257 0.44
258 0.46
259 0.46
260 0.48
261 0.49
262 0.5
263 0.45
264 0.47
265 0.42
266 0.46
267 0.5
268 0.48
269 0.47
270 0.48
271 0.51
272 0.47
273 0.47
274 0.42
275 0.43
276 0.45
277 0.44
278 0.38
279 0.34
280 0.31
281 0.28
282 0.29
283 0.25
284 0.21
285 0.18
286 0.18
287 0.16
288 0.14
289 0.14
290 0.15
291 0.13
292 0.14
293 0.15
294 0.17
295 0.18
296 0.19
297 0.18
298 0.16
299 0.17
300 0.15
301 0.14
302 0.17
303 0.18
304 0.23
305 0.25
306 0.28
307 0.36
308 0.4
309 0.47
310 0.48
311 0.49
312 0.53
313 0.56
314 0.56
315 0.5
316 0.46
317 0.39
318 0.38
319 0.4
320 0.34
321 0.31
322 0.3
323 0.29
324 0.32
325 0.34
326 0.33