Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F9YTH8

Protein Details
Accession A0A0F9YTH8    Localization Confidence High Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
149-175KQENKIDSPNKKKNKKDARNYNIKNGIHydrophilic
255-275VIEIKGIKQVKKKKKINYDELHydrophilic
NLS Segment(s)
PositionSequence
160-163KKNK
253-269KPVIEIKGIKQVKKKKK
Subcellular Location(s) nucl 14.5, cyto_nucl 12, cyto 8.5, mito 3
Family & Domain DBs
Amino Acid Sequences MSEIFFLKVITESNKRFIIKADPESTINSLIDLIKRYFAHYYSLKYFIKYIYTPDKFAILDNMPIKYFFNTGDICYIKGNEQDGKLGFLEGLVTKINYDQIQNINKSVAVMKEGPTILSSQKTVKPLNAKNFCGENERLTNETNVLENKQENKIDSPNKKKNKKDARNYNIKNGINPNLIINDTNKHKIYSKGEFATKKISNVIESPLSKPIEVSNDTDNKINLTEENKQDLDLKEKNTLFILENINDKPKEKPVIEIKGIKQVKKKKKINYDEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.38
3 0.38
4 0.39
5 0.42
6 0.42
7 0.47
8 0.45
9 0.42
10 0.43
11 0.45
12 0.44
13 0.37
14 0.29
15 0.21
16 0.19
17 0.18
18 0.18
19 0.19
20 0.17
21 0.19
22 0.2
23 0.22
24 0.24
25 0.23
26 0.27
27 0.27
28 0.32
29 0.31
30 0.38
31 0.36
32 0.35
33 0.35
34 0.3
35 0.32
36 0.27
37 0.29
38 0.32
39 0.34
40 0.34
41 0.33
42 0.34
43 0.3
44 0.3
45 0.29
46 0.19
47 0.23
48 0.23
49 0.24
50 0.21
51 0.22
52 0.22
53 0.18
54 0.18
55 0.13
56 0.14
57 0.14
58 0.14
59 0.19
60 0.19
61 0.18
62 0.18
63 0.18
64 0.16
65 0.18
66 0.19
67 0.17
68 0.17
69 0.19
70 0.19
71 0.2
72 0.18
73 0.16
74 0.13
75 0.1
76 0.1
77 0.07
78 0.08
79 0.06
80 0.06
81 0.06
82 0.07
83 0.09
84 0.09
85 0.09
86 0.11
87 0.17
88 0.22
89 0.23
90 0.23
91 0.21
92 0.21
93 0.21
94 0.19
95 0.13
96 0.11
97 0.11
98 0.11
99 0.14
100 0.14
101 0.13
102 0.12
103 0.13
104 0.12
105 0.12
106 0.12
107 0.12
108 0.15
109 0.19
110 0.2
111 0.22
112 0.29
113 0.34
114 0.43
115 0.45
116 0.43
117 0.41
118 0.42
119 0.4
120 0.36
121 0.32
122 0.24
123 0.21
124 0.21
125 0.21
126 0.19
127 0.19
128 0.15
129 0.14
130 0.13
131 0.11
132 0.1
133 0.11
134 0.12
135 0.14
136 0.16
137 0.17
138 0.17
139 0.18
140 0.24
141 0.31
142 0.38
143 0.46
144 0.52
145 0.61
146 0.69
147 0.73
148 0.77
149 0.8
150 0.82
151 0.82
152 0.84
153 0.83
154 0.86
155 0.83
156 0.8
157 0.78
158 0.68
159 0.6
160 0.53
161 0.49
162 0.39
163 0.36
164 0.28
165 0.21
166 0.21
167 0.18
168 0.15
169 0.15
170 0.17
171 0.22
172 0.22
173 0.22
174 0.24
175 0.3
176 0.35
177 0.36
178 0.39
179 0.38
180 0.44
181 0.45
182 0.44
183 0.47
184 0.42
185 0.37
186 0.34
187 0.31
188 0.27
189 0.26
190 0.28
191 0.25
192 0.25
193 0.26
194 0.27
195 0.27
196 0.25
197 0.24
198 0.23
199 0.23
200 0.23
201 0.24
202 0.25
203 0.29
204 0.3
205 0.32
206 0.3
207 0.25
208 0.24
209 0.22
210 0.18
211 0.18
212 0.24
213 0.26
214 0.31
215 0.3
216 0.3
217 0.34
218 0.33
219 0.36
220 0.33
221 0.33
222 0.35
223 0.36
224 0.36
225 0.32
226 0.33
227 0.27
228 0.27
229 0.29
230 0.23
231 0.27
232 0.28
233 0.33
234 0.33
235 0.32
236 0.31
237 0.34
238 0.39
239 0.36
240 0.42
241 0.45
242 0.53
243 0.58
244 0.62
245 0.57
246 0.6
247 0.64
248 0.61
249 0.61
250 0.63
251 0.67
252 0.71
253 0.77
254 0.77
255 0.83