Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0F9WB57

Protein Details
Accession A0A0F9WB57    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
93-127RKTGEATLRKPRRTRKDERKKAYKRFGTVKRAMKKBasic
NLS Segment(s)
PositionSequence
100-133LRKPRRTRKDERKKAYKRFGTVKRAMKKAERKNK
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
Amino Acid Sequences MSANCELEILLQKSNELLSRKELNLKIHHEESAVPPKKIITEKLSKLFQTKADNIIVYDITNCPGTHSSIGKVNIYSNLDDLKKVEKSYMVTRKTGEATLRKPRRTRKDERKKAYKRFGTVKRAMKKAERKNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.23
3 0.19
4 0.19
5 0.22
6 0.28
7 0.3
8 0.37
9 0.4
10 0.41
11 0.45
12 0.49
13 0.49
14 0.46
15 0.44
16 0.37
17 0.35
18 0.34
19 0.39
20 0.37
21 0.31
22 0.29
23 0.29
24 0.33
25 0.34
26 0.32
27 0.28
28 0.32
29 0.37
30 0.42
31 0.44
32 0.41
33 0.41
34 0.39
35 0.37
36 0.34
37 0.31
38 0.29
39 0.28
40 0.26
41 0.24
42 0.23
43 0.18
44 0.12
45 0.11
46 0.08
47 0.07
48 0.08
49 0.08
50 0.09
51 0.09
52 0.1
53 0.11
54 0.12
55 0.12
56 0.16
57 0.17
58 0.16
59 0.16
60 0.15
61 0.16
62 0.17
63 0.16
64 0.12
65 0.14
66 0.14
67 0.14
68 0.14
69 0.15
70 0.15
71 0.15
72 0.15
73 0.15
74 0.18
75 0.27
76 0.35
77 0.34
78 0.34
79 0.34
80 0.37
81 0.36
82 0.36
83 0.32
84 0.3
85 0.34
86 0.44
87 0.52
88 0.56
89 0.61
90 0.69
91 0.74
92 0.76
93 0.81
94 0.81
95 0.84
96 0.88
97 0.91
98 0.92
99 0.92
100 0.93
101 0.93
102 0.9
103 0.86
104 0.86
105 0.85
106 0.83
107 0.82
108 0.81
109 0.79
110 0.77
111 0.75
112 0.75
113 0.76