A0A0F9WSJ7

UniProt ID: A0A0F9WSJ7   Organism: Nosema ceranae
Gene: AAJ76_1100064476   Protein: 60s ribosomal protein l35
Length: 147 AA

Protein Details

• Accession: A0A0F9WSJ7
• Localization Confidence: Medium
• Confidence Score: 13.7
• NoLS Segment(s):

  Position	Sequence	Protein Nature
  76-119	HKIPKELRPKKTRAERRKLTKKQASRKMPKVWKRELKNPKIFFA	Basic

• NLS Segment(s):

  Position	Sequence
  77-113	KIPKELRPKKTRAERRKLTKKQASRKMPKVWKRELKN

• Subcellular Location(s): nucl 21.5, cyto_nucl 12, mito 4
• Family & Domain DBs:
  • InterPro:
    • IPR001854 Ribosomal_L29/L35
    • IPR036049 Ribosomal_L29/L35_sf
    • IPR045059 RL35
  • Gene Ontology:
    • GO:0022625 C:cytosolic large ribosomal subunit
    • GO:0003735 F:structural constituent of ribosome
    • GO:0000463 P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
    • GO:0006412 P:translation
  • Pfam:
    • PF00831 Ribosomal_L29
• Amino Acid Sequences: MKISLETFREKNISELEEEIINLKNELLQLRQKKVSSTVEPDEIKIARKNIARALRVRHEKLLEETCKKYENLPMHKIPKELRPKKTRAERRKLTKKQASRKMPKVWKRELKNPKIFFAYSE

NoLS Predictions per Residue - Data Table

Residue Number, Score
1, 0.24
2, 0.25
3, 0.22
4, 0.19
5, 0.19
6, 0.17
7, 0.16
8, 0.14
9, 0.12
10, 0.11
11, 0.1
12, 0.11
13, 0.13
14, 0.15
15, 0.2
16, 0.26
17, 0.31
18, 0.36
19, 0.36
20, 0.36
21, 0.41
22, 0.43
23, 0.4
24, 0.4
25, 0.38
26, 0.39
27, 0.39
28, 0.38
29, 0.35
30, 0.29
31, 0.28
32, 0.24
33, 0.22
34, 0.21
35, 0.23
36, 0.24
37, 0.28
38, 0.33
39, 0.33
40, 0.34
41, 0.38
42, 0.41
43, 0.46
44, 0.46
45, 0.42
46, 0.37
47, 0.35
48, 0.36
49, 0.37
50, 0.33
51, 0.3
52, 0.3
53, 0.29
54, 0.3
55, 0.29
56, 0.27
57, 0.26
58, 0.3
59, 0.33
60, 0.37
61, 0.42
62, 0.47
63, 0.48
64, 0.5
65, 0.46
66, 0.46
67, 0.51
68, 0.53
69, 0.57
70, 0.59
71, 0.62
72, 0.69
73, 0.77
74, 0.79
75, 0.79
76, 0.82
77, 0.82
78, 0.85
79, 0.91
80, 0.91
81, 0.91
82, 0.9
83, 0.89
84, 0.89
85, 0.9
86, 0.9
87, 0.89
88, 0.88
89, 0.88
90, 0.88
91, 0.87
92, 0.85
93, 0.86
94, 0.85
95, 0.82
96, 0.84
97, 0.85
98, 0.85
99, 0.86
100, 0.81
101, 0.76
102, 0.71