Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F9WSJ7

Protein Details
Accession A0A0F9WSJ7    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
76-119HKIPKELRPKKTRAERRKLTKKQASRKMPKVWKRELKNPKIFFABasic
NLS Segment(s)
PositionSequence
77-113KIPKELRPKKTRAERRKLTKKQASRKMPKVWKRELKN
Subcellular Location(s) nucl 21.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
Amino Acid Sequences MKISLETFREKNISELEEEIINLKNELLQLRQKKVSSTVEPDEIKIARKNIARALRVRHEKLLEETCKKYENLPMHKIPKELRPKKTRAERRKLTKKQASRKMPKVWKRELKNPKIFFAYSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.25
3 0.22
4 0.19
5 0.19
6 0.17
7 0.16
8 0.14
9 0.12
10 0.11
11 0.1
12 0.11
13 0.13
14 0.15
15 0.2
16 0.26
17 0.31
18 0.36
19 0.36
20 0.36
21 0.41
22 0.43
23 0.4
24 0.4
25 0.38
26 0.39
27 0.39
28 0.38
29 0.35
30 0.29
31 0.28
32 0.24
33 0.22
34 0.21
35 0.23
36 0.24
37 0.28
38 0.33
39 0.33
40 0.34
41 0.38
42 0.41
43 0.46
44 0.46
45 0.42
46 0.37
47 0.35
48 0.36
49 0.37
50 0.33
51 0.3
52 0.3
53 0.29
54 0.3
55 0.29
56 0.27
57 0.26
58 0.3
59 0.33
60 0.37
61 0.42
62 0.47
63 0.48
64 0.5
65 0.46
66 0.46
67 0.51
68 0.53
69 0.57
70 0.59
71 0.62
72 0.69
73 0.77
74 0.79
75 0.79
76 0.82
77 0.82
78 0.85
79 0.91
80 0.91
81 0.91
82 0.9
83 0.89
84 0.89
85 0.9
86 0.9
87 0.89
88 0.88
89 0.88
90 0.88
91 0.87
92 0.85
93 0.86
94 0.85
95 0.82
96 0.84
97 0.85
98 0.85
99 0.86
100 0.81
101 0.76
102 0.71