Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F9WDL2

Protein Details
Accession A0A0F9WDL2    Localization Confidence High Confidence Score 16.3
NoLS Segment(s)
PositionSequenceProtein Nature
28-67VDKYPKYRSRILKKYIKKEYKKISKSKKLRKVKDLQYFLNHydrophilic
134-156MIKYHVQGKKHNKNKKSGRFLNLHydrophilic
NLS Segment(s)
PositionSequence
35-59RSRILKKYIKKEYKKISKSKKLRKV
143-149KHNKNKK
Subcellular Location(s) nucl 16, cyto_nucl 13, cyto 8
Family & Domain DBs
Amino Acid Sequences MKHTKDDLKKYIVLLERLEVLYNMYNDVDKYPKYRSRILKKYIKKEYKKISKSKKLRKVKDLQYFLNKSDLIYNLDFKEHFKTINNEFDLLKFYDKILLFFKKKYKSVFELVTETTLNKNVFCVDCKRELKGTMIKYHVQGKKHNKNKKSGRFLNLIGNKEQLKKSALFIVDKINKEKGCGDV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.33
3 0.3
4 0.28
5 0.27
6 0.2
7 0.17
8 0.17
9 0.16
10 0.16
11 0.13
12 0.13
13 0.13
14 0.16
15 0.17
16 0.15
17 0.19
18 0.26
19 0.31
20 0.36
21 0.44
22 0.52
23 0.59
24 0.67
25 0.73
26 0.75
27 0.78
28 0.84
29 0.86
30 0.86
31 0.83
32 0.83
33 0.85
34 0.85
35 0.85
36 0.85
37 0.85
38 0.85
39 0.88
40 0.9
41 0.89
42 0.89
43 0.88
44 0.88
45 0.87
46 0.86
47 0.85
48 0.8
49 0.75
50 0.73
51 0.67
52 0.59
53 0.53
54 0.42
55 0.33
56 0.29
57 0.26
58 0.2
59 0.18
60 0.19
61 0.16
62 0.17
63 0.17
64 0.15
65 0.18
66 0.15
67 0.15
68 0.15
69 0.19
70 0.21
71 0.28
72 0.27
73 0.24
74 0.24
75 0.23
76 0.23
77 0.2
78 0.17
79 0.11
80 0.1
81 0.14
82 0.14
83 0.15
84 0.16
85 0.21
86 0.22
87 0.26
88 0.33
89 0.33
90 0.36
91 0.38
92 0.4
93 0.38
94 0.41
95 0.41
96 0.36
97 0.34
98 0.31
99 0.29
100 0.24
101 0.21
102 0.17
103 0.18
104 0.15
105 0.12
106 0.12
107 0.13
108 0.13
109 0.15
110 0.2
111 0.2
112 0.28
113 0.3
114 0.33
115 0.33
116 0.34
117 0.37
118 0.38
119 0.39
120 0.36
121 0.38
122 0.38
123 0.38
124 0.46
125 0.44
126 0.41
127 0.46
128 0.51
129 0.58
130 0.66
131 0.73
132 0.69
133 0.76
134 0.83
135 0.84
136 0.84
137 0.82
138 0.78
139 0.75
140 0.71
141 0.71
142 0.67
143 0.59
144 0.5
145 0.46
146 0.43
147 0.43
148 0.42
149 0.34
150 0.31
151 0.3
152 0.3
153 0.32
154 0.32
155 0.29
156 0.29
157 0.37
158 0.4
159 0.42
160 0.44
161 0.45
162 0.42
163 0.43