Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F9ZET2

Protein Details
Accession A0A0F9ZET2   
Localization Confidence Medium
Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MPNRKGLPQKIKKPKLPRRKTIGFCKGNTHydrophilic
NLS Segment(s)
PositionSequence
4-20RKGLPQKIKKPKLPRRK
58-81LAKAKRGNIGSRTPNKTIRAKVKK
Subcellular Location(s) mito 12, nucl 11, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR029526  PGBD  
Pfam View protein in Pfam  
PF13843  DDE_Tnp_1_7  
Amino Acid Sequences MPNRKGLPQKIKKPKLPRRKTIGFCKGNTPTLAWCDTRVVTLLSTFYTSDSQTIQRRLAKAKRGNIGSRTPNKTIRAKVKKPIVIVNYNEYMGSVDVADQYTSSYAF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.9
3 0.9
4 0.89
5 0.87
6 0.88
7 0.87
8 0.86
9 0.86
10 0.81
11 0.73
12 0.71
13 0.66
14 0.59
15 0.52
16 0.42
17 0.33
18 0.3
19 0.31
20 0.23
21 0.2
22 0.19
23 0.18
24 0.17
25 0.16
26 0.13
27 0.1
28 0.1
29 0.09
30 0.08
31 0.08
32 0.08
33 0.08
34 0.09
35 0.09
36 0.09
37 0.1
38 0.14
39 0.17
40 0.19
41 0.21
42 0.23
43 0.25
44 0.31
45 0.35
46 0.4
47 0.43
48 0.47
49 0.49
50 0.51
51 0.53
52 0.5
53 0.52
54 0.51
55 0.53
56 0.53
57 0.5
58 0.51
59 0.53
60 0.55
61 0.56
62 0.58
63 0.61
64 0.61
65 0.65
66 0.69
67 0.67
68 0.64
69 0.64
70 0.59
71 0.55
72 0.52
73 0.49
74 0.42
75 0.38
76 0.35
77 0.28
78 0.23
79 0.16
80 0.14
81 0.08
82 0.07
83 0.08
84 0.09
85 0.09
86 0.08
87 0.08