Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0F9ZH44

Protein Details
Accession A0A0F9ZH44    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
61-82FQYHKLRQKNAQKDKRFSRDKKBasic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 12, cyto 5.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR003923  TFIID_30kDa  
Gene Ontology GO:0005634  C:nucleus  
GO:0003743  F:translation initiation factor activity  
GO:0006352  P:DNA-templated transcription initiation  
Pfam View protein in Pfam  
PF03540  TFIID_30kDa  
CDD cd07982  TAF10  
Amino Acid Sequences MKDVEFEEFKQNLDEYIPLIPDSVLDYYMQKSGVTSSDTNVKKLVSLLSHKFISDVCASSFQYHKLRQKNAQKDKRFSRDKKASLQVVDVEKALEEIGINISRPHYYM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.12
3 0.13
4 0.13
5 0.11
6 0.11
7 0.1
8 0.09
9 0.1
10 0.1
11 0.08
12 0.08
13 0.1
14 0.1
15 0.12
16 0.12
17 0.1
18 0.09
19 0.1
20 0.11
21 0.13
22 0.12
23 0.12
24 0.21
25 0.22
26 0.22
27 0.22
28 0.2
29 0.17
30 0.18
31 0.18
32 0.12
33 0.17
34 0.18
35 0.21
36 0.21
37 0.21
38 0.2
39 0.19
40 0.18
41 0.14
42 0.13
43 0.1
44 0.12
45 0.12
46 0.14
47 0.15
48 0.16
49 0.2
50 0.26
51 0.33
52 0.37
53 0.42
54 0.5
55 0.59
56 0.66
57 0.72
58 0.76
59 0.77
60 0.79
61 0.83
62 0.84
63 0.84
64 0.78
65 0.78
66 0.78
67 0.75
68 0.75
69 0.74
70 0.69
71 0.6
72 0.57
73 0.51
74 0.44
75 0.4
76 0.31
77 0.23
78 0.18
79 0.17
80 0.14
81 0.09
82 0.06
83 0.05
84 0.09
85 0.1
86 0.11
87 0.11
88 0.13