Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0F9ZCF1

Protein Details
Accession A0A0F9ZCF1    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
238-258MVKELDKKKRIKKINIKEIEEBasic
NLS Segment(s)
PositionSequence
244-250KKKRIKK
Subcellular Location(s) nucl 14, cyto_nucl 11.5, cyto 7, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR043154  Sec-1-like_dom1  
IPR001619  Sec1-like  
IPR027482  Sec1-like_dom2  
IPR036045  Sec1-like_sf  
Gene Ontology GO:0016192  P:vesicle-mediated transport  
Pfam View protein in Pfam  
PF00995  Sec1  
Amino Acid Sequences MDFLLPKISKILTASDGVKCLLFDTFTKSSISSLIPHSHFLNNDYFLFDDIQNTRKKVNINCVCVLSISSIKNLIQEISNPSYRTYTVLFTTTIDPYLLNLLAKNDIYGVIREIHEIYMDFCKQDSYLFTLNNINNFIYSLGSKPTFYHYKQNYEDVVKDPFIDLNSEGGRVFVINRSYDNITPLIIDWHYQAMIKKYCNYNDGLVKIYDNTYCMDDDFFQNNKFKNISEVSTNIELMVKELDKKKRIKKINIKEIEEINKLGDIVKKHMDIYNCIINNLEEKKQLSENENLMLKKFKKGELSFNNFNENIKDLNKCVNINLLNILKSTDKKLKFDFKKQEDIKLAYVPPICKIAKDILKGKMDDWICLDERFNKSKYTVFYFKGGVTYTEYRHIMIYFKEHKNVYVVSESITS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.26
3 0.27
4 0.26
5 0.25
6 0.21
7 0.19
8 0.16
9 0.14
10 0.12
11 0.19
12 0.2
13 0.21
14 0.23
15 0.22
16 0.22
17 0.23
18 0.23
19 0.19
20 0.21
21 0.28
22 0.28
23 0.3
24 0.32
25 0.33
26 0.33
27 0.33
28 0.33
29 0.28
30 0.27
31 0.26
32 0.24
33 0.21
34 0.23
35 0.2
36 0.2
37 0.2
38 0.25
39 0.29
40 0.3
41 0.3
42 0.31
43 0.37
44 0.38
45 0.47
46 0.49
47 0.51
48 0.52
49 0.52
50 0.49
51 0.43
52 0.37
53 0.29
54 0.25
55 0.2
56 0.18
57 0.19
58 0.18
59 0.2
60 0.2
61 0.18
62 0.14
63 0.16
64 0.21
65 0.24
66 0.27
67 0.26
68 0.27
69 0.28
70 0.27
71 0.26
72 0.22
73 0.19
74 0.18
75 0.19
76 0.18
77 0.18
78 0.2
79 0.19
80 0.17
81 0.15
82 0.13
83 0.12
84 0.14
85 0.13
86 0.1
87 0.1
88 0.1
89 0.12
90 0.12
91 0.12
92 0.1
93 0.1
94 0.11
95 0.11
96 0.11
97 0.11
98 0.12
99 0.13
100 0.13
101 0.12
102 0.12
103 0.11
104 0.12
105 0.14
106 0.14
107 0.13
108 0.12
109 0.13
110 0.12
111 0.13
112 0.13
113 0.14
114 0.17
115 0.17
116 0.19
117 0.25
118 0.26
119 0.27
120 0.27
121 0.21
122 0.18
123 0.18
124 0.16
125 0.1
126 0.1
127 0.09
128 0.11
129 0.11
130 0.12
131 0.12
132 0.17
133 0.23
134 0.24
135 0.33
136 0.34
137 0.42
138 0.43
139 0.46
140 0.44
141 0.4
142 0.4
143 0.32
144 0.31
145 0.23
146 0.21
147 0.17
148 0.15
149 0.13
150 0.13
151 0.11
152 0.11
153 0.11
154 0.11
155 0.1
156 0.09
157 0.09
158 0.08
159 0.08
160 0.08
161 0.1
162 0.1
163 0.1
164 0.13
165 0.15
166 0.15
167 0.17
168 0.14
169 0.12
170 0.12
171 0.11
172 0.1
173 0.08
174 0.08
175 0.07
176 0.08
177 0.08
178 0.09
179 0.1
180 0.14
181 0.17
182 0.17
183 0.21
184 0.24
185 0.25
186 0.26
187 0.26
188 0.24
189 0.24
190 0.24
191 0.21
192 0.18
193 0.17
194 0.15
195 0.15
196 0.12
197 0.1
198 0.09
199 0.09
200 0.08
201 0.08
202 0.09
203 0.08
204 0.11
205 0.14
206 0.14
207 0.16
208 0.19
209 0.2
210 0.21
211 0.21
212 0.19
213 0.2
214 0.2
215 0.19
216 0.18
217 0.18
218 0.19
219 0.2
220 0.19
221 0.15
222 0.14
223 0.12
224 0.11
225 0.11
226 0.08
227 0.11
228 0.18
229 0.24
230 0.3
231 0.38
232 0.45
233 0.53
234 0.62
235 0.69
236 0.73
237 0.78
238 0.82
239 0.83
240 0.79
241 0.73
242 0.68
243 0.62
244 0.53
245 0.42
246 0.32
247 0.24
248 0.2
249 0.18
250 0.16
251 0.13
252 0.15
253 0.17
254 0.18
255 0.19
256 0.21
257 0.21
258 0.22
259 0.24
260 0.28
261 0.25
262 0.24
263 0.23
264 0.21
265 0.25
266 0.25
267 0.23
268 0.18
269 0.19
270 0.21
271 0.24
272 0.27
273 0.25
274 0.27
275 0.27
276 0.28
277 0.31
278 0.29
279 0.27
280 0.31
281 0.29
282 0.3
283 0.31
284 0.31
285 0.36
286 0.39
287 0.48
288 0.51
289 0.58
290 0.59
291 0.58
292 0.59
293 0.51
294 0.49
295 0.39
296 0.31
297 0.25
298 0.2
299 0.21
300 0.17
301 0.24
302 0.26
303 0.25
304 0.24
305 0.28
306 0.27
307 0.26
308 0.3
309 0.25
310 0.22
311 0.22
312 0.23
313 0.2
314 0.2
315 0.25
316 0.29
317 0.31
318 0.35
319 0.42
320 0.51
321 0.56
322 0.65
323 0.69
324 0.66
325 0.74
326 0.72
327 0.73
328 0.69
329 0.65
330 0.57
331 0.51
332 0.46
333 0.4
334 0.41
335 0.34
336 0.29
337 0.32
338 0.29
339 0.24
340 0.27
341 0.3
342 0.32
343 0.38
344 0.43
345 0.44
346 0.49
347 0.5
348 0.47
349 0.46
350 0.4
351 0.35
352 0.32
353 0.29
354 0.25
355 0.26
356 0.28
357 0.28
358 0.34
359 0.38
360 0.37
361 0.35
362 0.35
363 0.39
364 0.42
365 0.43
366 0.44
367 0.41
368 0.43
369 0.42
370 0.41
371 0.39
372 0.35
373 0.28
374 0.27
375 0.29
376 0.28
377 0.32
378 0.32
379 0.3
380 0.3
381 0.29
382 0.25
383 0.24
384 0.31
385 0.33
386 0.37
387 0.43
388 0.42
389 0.43
390 0.45
391 0.44
392 0.38
393 0.33
394 0.29