Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F9W8X8

Protein Details
Accession A0A0F9W8X8    Localization Confidence Medium Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
31-51SIAVKKFRKHLKKMLKTDEKIHydrophilic
NLS Segment(s)
PositionSequence
34-44VKKFRKHLKKM
65-74GLRKVPRRVR
Subcellular Location(s) nucl 13, mito 10, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000054  Ribosomal_L31e  
IPR023621  Ribosomal_L31e_dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01198  Ribosomal_L31e  
Amino Acid Sequences MKTALENNKTMELTVNLGKITKGCNWTKKASIAVKKFRKHLKKMLKTDEKITIQKDLNKFIFSKGLRKVPRRVRIKVERIPDKDNAELNVIKCSHVLVGNFKGLKTEVVKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.21
3 0.17
4 0.17
5 0.17
6 0.16
7 0.17
8 0.19
9 0.23
10 0.28
11 0.36
12 0.4
13 0.45
14 0.47
15 0.47
16 0.5
17 0.51
18 0.54
19 0.55
20 0.6
21 0.64
22 0.65
23 0.69
24 0.71
25 0.72
26 0.7
27 0.72
28 0.73
29 0.74
30 0.78
31 0.82
32 0.81
33 0.74
34 0.7
35 0.67
36 0.6
37 0.53
38 0.46
39 0.4
40 0.33
41 0.36
42 0.34
43 0.31
44 0.28
45 0.26
46 0.26
47 0.21
48 0.26
49 0.22
50 0.27
51 0.26
52 0.34
53 0.39
54 0.44
55 0.52
56 0.55
57 0.64
58 0.65
59 0.66
60 0.68
61 0.71
62 0.75
63 0.72
64 0.72
65 0.72
66 0.69
67 0.68
68 0.63
69 0.56
70 0.51
71 0.46
72 0.38
73 0.33
74 0.31
75 0.28
76 0.29
77 0.25
78 0.22
79 0.2
80 0.19
81 0.17
82 0.17
83 0.18
84 0.19
85 0.22
86 0.28
87 0.29
88 0.28
89 0.28
90 0.26
91 0.29