Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F9ZGY8

Protein Details
Accession A0A0F9ZGY8   
Localization Confidence Medium
Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
13-40ALKAASTSKKEKKKWTEIKKKDEARKIFHydrophilic
NLS Segment(s)
PositionSequence
9-37KEKKALKAASTSKKEKKKWTEIKKKDEAR
Subcellular Location(s) nucl 19.5, cyto_nucl 12.833, mito_nucl 11.166, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAKKVQETKEKKALKAASTSKKEKKKWTEIKKKDEARKIFTVSDELLQKVEKEVKKAKIVTVFSLGSKMNLTLSVAKNLLRHCVNNGIISLIHKSSKTTIYGQPLEVEQIPVQQEVSVAEGDGWN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.58
3 0.59
4 0.59
5 0.62
6 0.69
7 0.7
8 0.74
9 0.77
10 0.78
11 0.79
12 0.8
13 0.82
14 0.85
15 0.87
16 0.87
17 0.9
18 0.89
19 0.89
20 0.86
21 0.85
22 0.8
23 0.75
24 0.7
25 0.64
26 0.55
27 0.47
28 0.4
29 0.32
30 0.29
31 0.23
32 0.18
33 0.16
34 0.15
35 0.14
36 0.13
37 0.19
38 0.17
39 0.21
40 0.27
41 0.31
42 0.36
43 0.37
44 0.37
45 0.36
46 0.36
47 0.32
48 0.29
49 0.25
50 0.2
51 0.21
52 0.19
53 0.13
54 0.12
55 0.1
56 0.07
57 0.07
58 0.08
59 0.11
60 0.12
61 0.14
62 0.14
63 0.16
64 0.18
65 0.19
66 0.23
67 0.19
68 0.19
69 0.19
70 0.24
71 0.24
72 0.23
73 0.22
74 0.18
75 0.17
76 0.18
77 0.18
78 0.13
79 0.13
80 0.12
81 0.14
82 0.16
83 0.18
84 0.2
85 0.22
86 0.26
87 0.33
88 0.35
89 0.34
90 0.32
91 0.3
92 0.3
93 0.26
94 0.23
95 0.16
96 0.17
97 0.18
98 0.16
99 0.16
100 0.13
101 0.13
102 0.11
103 0.13
104 0.1
105 0.08