Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F9WQM7

Protein Details
Accession A0A0F9WQM7   
Localization Confidence High
Confidence Score 17.6
NoLS Segment(s)
PositionSequenceProtein Nature
33-65EEEKYSKKKIRQLSKKSHKKKAKTCTNVKLENNHydrophilic
136-163KSKLEYPKVNEKEKNRFKPKAKKRIKKRBasic
NLS Segment(s)
PositionSequence
39-55KKKIRQLSKKSHKKKAK
88-163SRKERRMLKIKNNGKGLSSKEFMKVYKEGDGRKIVKEDRERSKLHIPSKSKLEYPKVNEKEKNRFKPKAKKRIKKR
Subcellular Location(s) nucl 21.5, cyto_nucl 13, mito 4
Family & Domain DBs
Amino Acid Sequences MSNVTEKQLHKQSLTKVVDYLNEKNNNETENTEEEKYSKKKIRQLSKKSHKKKAKTCTNVKLENNNIIESTKSIAFNEKNANNEEKLSRKERRMLKIKNNGKGLSSKEFMKVYKEGDGRKIVKEDRERSKLHIPSKSKLEYPKVNEKEKNRFKPKAKKRIKKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.47
3 0.41
4 0.39
5 0.41
6 0.41
7 0.41
8 0.39
9 0.43
10 0.42
11 0.43
12 0.44
13 0.39
14 0.36
15 0.31
16 0.27
17 0.25
18 0.28
19 0.25
20 0.24
21 0.24
22 0.3
23 0.32
24 0.37
25 0.39
26 0.42
27 0.48
28 0.57
29 0.67
30 0.7
31 0.77
32 0.8
33 0.83
34 0.88
35 0.9
36 0.91
37 0.89
38 0.88
39 0.88
40 0.87
41 0.87
42 0.85
43 0.85
44 0.84
45 0.83
46 0.81
47 0.74
48 0.71
49 0.62
50 0.59
51 0.51
52 0.41
53 0.34
54 0.26
55 0.23
56 0.16
57 0.16
58 0.1
59 0.09
60 0.09
61 0.14
62 0.14
63 0.16
64 0.22
65 0.22
66 0.23
67 0.24
68 0.26
69 0.22
70 0.23
71 0.22
72 0.2
73 0.22
74 0.27
75 0.3
76 0.31
77 0.38
78 0.44
79 0.51
80 0.57
81 0.61
82 0.64
83 0.7
84 0.74
85 0.74
86 0.71
87 0.63
88 0.54
89 0.5
90 0.44
91 0.39
92 0.34
93 0.28
94 0.26
95 0.28
96 0.27
97 0.27
98 0.25
99 0.22
100 0.27
101 0.3
102 0.28
103 0.31
104 0.38
105 0.36
106 0.37
107 0.4
108 0.36
109 0.41
110 0.48
111 0.51
112 0.53
113 0.57
114 0.56
115 0.57
116 0.63
117 0.62
118 0.6
119 0.61
120 0.57
121 0.56
122 0.62
123 0.6
124 0.56
125 0.56
126 0.57
127 0.57
128 0.59
129 0.64
130 0.63
131 0.68
132 0.71
133 0.72
134 0.75
135 0.77
136 0.81
137 0.8
138 0.83
139 0.84
140 0.88
141 0.91
142 0.91
143 0.91