Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F9WGY2

Protein Details
Accession A0A0F9WGY2   
Localization Confidence Medium
Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MKTPKKRVTLKTPKRSTKSTFKSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto_nucl 14, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR031519  DUF5094  
Pfam View protein in Pfam  
PF17015  DUF5094  
Amino Acid Sequences MKTPKKRVTLKTPKRSTKSTFKSTGHTKGVKDESDSVTKKKDSPSKFIADLDIEIKNTENELITSLQKENELLRSTNLYVKFLGLDITQVGDKYVVKYNVNKDNRFLHFELVPEDDMYVYSLVRSENIDELGVLGDEISFEKEQIAKFFYKVMEIMISD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.85
3 0.81
4 0.81
5 0.79
6 0.76
7 0.75
8 0.67
9 0.68
10 0.69
11 0.69
12 0.66
13 0.61
14 0.54
15 0.53
16 0.56
17 0.49
18 0.45
19 0.41
20 0.37
21 0.41
22 0.43
23 0.37
24 0.37
25 0.37
26 0.37
27 0.4
28 0.45
29 0.41
30 0.45
31 0.49
32 0.49
33 0.49
34 0.46
35 0.4
36 0.33
37 0.29
38 0.24
39 0.19
40 0.14
41 0.12
42 0.12
43 0.1
44 0.1
45 0.09
46 0.07
47 0.06
48 0.07
49 0.09
50 0.09
51 0.1
52 0.11
53 0.11
54 0.11
55 0.11
56 0.11
57 0.13
58 0.14
59 0.13
60 0.13
61 0.15
62 0.15
63 0.19
64 0.18
65 0.15
66 0.14
67 0.13
68 0.13
69 0.11
70 0.1
71 0.06
72 0.06
73 0.05
74 0.05
75 0.06
76 0.05
77 0.05
78 0.06
79 0.06
80 0.08
81 0.13
82 0.14
83 0.16
84 0.2
85 0.27
86 0.36
87 0.42
88 0.4
89 0.39
90 0.43
91 0.45
92 0.46
93 0.41
94 0.34
95 0.29
96 0.29
97 0.27
98 0.23
99 0.2
100 0.14
101 0.13
102 0.11
103 0.1
104 0.1
105 0.08
106 0.06
107 0.05
108 0.06
109 0.06
110 0.07
111 0.08
112 0.09
113 0.1
114 0.11
115 0.11
116 0.1
117 0.1
118 0.1
119 0.09
120 0.07
121 0.05
122 0.04
123 0.04
124 0.05
125 0.08
126 0.08
127 0.08
128 0.1
129 0.13
130 0.14
131 0.17
132 0.2
133 0.18
134 0.19
135 0.22
136 0.21
137 0.21
138 0.2
139 0.19