Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0F9YPZ1

Protein Details
Accession A0A0F9YPZ1    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
4-30CINKLVICSKKPKKRAKTLCTVFRKLFHydrophilic
NLS Segment(s)
PositionSequence
14-18KPKKR
Subcellular Location(s) nucl 17, cyto_nucl 11, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR007109  Brix  
Gene Ontology GO:0019843  F:rRNA binding  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF04427  Brix  
PROSITE View protein in PROSITE  
PS50833  BRIX  
Amino Acid Sequences MDECINKLVICSKKPKKRAKTLCTVFRKLFLPNTTYKLKDKNVSVRRYKSLGEDLKMSHFIVTADNYIKIGQRPNGPTFTFSIEEFEEKMKIFSNAIYSTDPLITITGESKYNDFFTNLSHPNNTPERNINFHFENDFIQIRHYKIETVEEENIKVGLTEIGPRLTLRIKKIEEDFFPI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.76
3 0.79
4 0.84
5 0.9
6 0.88
7 0.89
8 0.88
9 0.89
10 0.87
11 0.83
12 0.73
13 0.66
14 0.6
15 0.52
16 0.49
17 0.42
18 0.37
19 0.34
20 0.38
21 0.39
22 0.4
23 0.41
24 0.41
25 0.43
26 0.44
27 0.47
28 0.52
29 0.56
30 0.62
31 0.66
32 0.64
33 0.64
34 0.61
35 0.56
36 0.49
37 0.5
38 0.46
39 0.39
40 0.36
41 0.32
42 0.32
43 0.33
44 0.28
45 0.19
46 0.15
47 0.13
48 0.12
49 0.12
50 0.11
51 0.11
52 0.11
53 0.11
54 0.11
55 0.12
56 0.12
57 0.14
58 0.15
59 0.2
60 0.24
61 0.26
62 0.3
63 0.29
64 0.28
65 0.27
66 0.27
67 0.22
68 0.18
69 0.17
70 0.14
71 0.14
72 0.14
73 0.13
74 0.1
75 0.09
76 0.1
77 0.08
78 0.08
79 0.08
80 0.08
81 0.1
82 0.1
83 0.12
84 0.12
85 0.12
86 0.12
87 0.12
88 0.11
89 0.08
90 0.08
91 0.06
92 0.06
93 0.06
94 0.07
95 0.08
96 0.09
97 0.09
98 0.1
99 0.12
100 0.12
101 0.12
102 0.11
103 0.12
104 0.18
105 0.2
106 0.21
107 0.21
108 0.21
109 0.26
110 0.32
111 0.31
112 0.28
113 0.31
114 0.33
115 0.37
116 0.38
117 0.37
118 0.33
119 0.33
120 0.31
121 0.25
122 0.24
123 0.22
124 0.21
125 0.17
126 0.19
127 0.2
128 0.19
129 0.22
130 0.21
131 0.19
132 0.19
133 0.25
134 0.24
135 0.27
136 0.31
137 0.3
138 0.29
139 0.29
140 0.27
141 0.21
142 0.18
143 0.13
144 0.09
145 0.08
146 0.11
147 0.12
148 0.13
149 0.14
150 0.14
151 0.17
152 0.22
153 0.27
154 0.28
155 0.36
156 0.37
157 0.43
158 0.49
159 0.52