Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F9WIJ0

Protein Details
Accession A0A0F9WIJ0   
Localization Confidence Low
Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
3-24MRYQRETKIKYRHKMEYCKEEDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10.5, mito_nucl 10, nucl 8.5, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR036915  Cyclin-like_sf  
IPR006671  Cyclin_N  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF00134  Cyclin_N  
Amino Acid Sequences MGMRYQRETKIKYRHKMEYCKEEDISEKIIKRIVQNYLNHKCCFSSLVDLKNILPLYLICGFIYLKRYLKNMKNRLKDSVLTKIFLTCCWIAIKNFNDSYVASQDFLDNYKCNNKEIIFIEAHLLSKINYNIDITQLEIMNWDID
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.78
3 0.83
4 0.82
5 0.82
6 0.77
7 0.73
8 0.66
9 0.57
10 0.51
11 0.44
12 0.4
13 0.35
14 0.31
15 0.26
16 0.29
17 0.29
18 0.3
19 0.32
20 0.34
21 0.35
22 0.4
23 0.49
24 0.55
25 0.59
26 0.55
27 0.51
28 0.44
29 0.38
30 0.34
31 0.26
32 0.24
33 0.23
34 0.26
35 0.27
36 0.27
37 0.27
38 0.28
39 0.27
40 0.18
41 0.14
42 0.1
43 0.12
44 0.13
45 0.13
46 0.09
47 0.1
48 0.1
49 0.11
50 0.15
51 0.13
52 0.14
53 0.15
54 0.18
55 0.24
56 0.31
57 0.4
58 0.47
59 0.54
60 0.6
61 0.6
62 0.62
63 0.58
64 0.54
65 0.47
66 0.46
67 0.38
68 0.31
69 0.29
70 0.28
71 0.25
72 0.22
73 0.22
74 0.13
75 0.13
76 0.14
77 0.15
78 0.13
79 0.2
80 0.21
81 0.23
82 0.23
83 0.22
84 0.22
85 0.21
86 0.23
87 0.2
88 0.19
89 0.14
90 0.14
91 0.14
92 0.14
93 0.15
94 0.15
95 0.12
96 0.14
97 0.22
98 0.23
99 0.23
100 0.27
101 0.26
102 0.29
103 0.3
104 0.32
105 0.24
106 0.24
107 0.25
108 0.22
109 0.22
110 0.17
111 0.15
112 0.11
113 0.15
114 0.16
115 0.15
116 0.15
117 0.17
118 0.17
119 0.19
120 0.19
121 0.16
122 0.17
123 0.16
124 0.15
125 0.14