Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F9WDR4

Protein Details
Accession A0A0F9WDR4    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MTSTIKKPRLWRIRKNKRVSLKAKKCLETCHydrophilic
NLS Segment(s)
PositionSequence
6-24KKPRLWRIRKNKRVSLKAK
Subcellular Location(s) mito 19.5, mito_nucl 13.5, nucl 6.5
Family & Domain DBs
Amino Acid Sequences MTSTIKKPRLWRIRKNKRVSLKAKKCLETCMSKFNCRVFARNCACGKKAFDDAIRPVNFRVKGVFVTISLICRNAASIRTILTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.91
3 0.89
4 0.88
5 0.89
6 0.88
7 0.88
8 0.87
9 0.86
10 0.84
11 0.81
12 0.71
13 0.67
14 0.61
15 0.58
16 0.5
17 0.51
18 0.47
19 0.44
20 0.47
21 0.43
22 0.46
23 0.39
24 0.42
25 0.35
26 0.41
27 0.41
28 0.45
29 0.46
30 0.4
31 0.39
32 0.36
33 0.36
34 0.29
35 0.29
36 0.24
37 0.23
38 0.24
39 0.26
40 0.32
41 0.31
42 0.29
43 0.27
44 0.31
45 0.3
46 0.27
47 0.26
48 0.19
49 0.19
50 0.2
51 0.2
52 0.13
53 0.16
54 0.16
55 0.17
56 0.16
57 0.16
58 0.14
59 0.13
60 0.14
61 0.13
62 0.14
63 0.14
64 0.14