Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0F9W6Y6

Protein Details
Accession A0A0F9W6Y6    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
32-62ISLLKDKKRKDNDLKIQKRSNKKLRFENKIDHydrophilic
NLS Segment(s)
PositionSequence
38-54KKRKDNDLKIQKRSNKK
Subcellular Location(s) nucl 12.5, mito 9, cyto_nucl 9, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MNFICFLLVFKKVISSHLDKHERIYNFKYPMISLLKDKKRKDNDLKIQKRSNKKLRFENKIDVNVDIDKGKLNLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.27
3 0.3
4 0.4
5 0.46
6 0.41
7 0.45
8 0.49
9 0.46
10 0.45
11 0.45
12 0.42
13 0.39
14 0.4
15 0.37
16 0.3
17 0.32
18 0.3
19 0.25
20 0.24
21 0.3
22 0.37
23 0.44
24 0.46
25 0.51
26 0.54
27 0.63
28 0.67
29 0.69
30 0.71
31 0.75
32 0.81
33 0.8
34 0.81
35 0.8
36 0.8
37 0.8
38 0.8
39 0.78
40 0.77
41 0.8
42 0.81
43 0.83
44 0.79
45 0.78
46 0.75
47 0.72
48 0.66
49 0.56
50 0.49
51 0.41
52 0.36
53 0.28
54 0.21
55 0.16