Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F9WPS5

Protein Details
Accession A0A0F9WPS5    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
23-48FYTLKSKENSPVKKKKRYSDLLKDPLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto_nucl 14.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR031509  Mei5-like  
Pfam View protein in Pfam  
PF17021  Mei5_like  
Amino Acid Sequences MYYKTKPQDENEYQKIQIDNKIFYTLKSKENSPVKKKKRYSDLLKDPLYIQQDLYRKLNMIKHFRNKNGDLFSLIDKWKSLIDECIILMKRDYEVSVQELFNLFRLEDYGFNIENYE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.53
3 0.45
4 0.42
5 0.36
6 0.32
7 0.29
8 0.35
9 0.31
10 0.29
11 0.34
12 0.31
13 0.33
14 0.33
15 0.33
16 0.36
17 0.46
18 0.54
19 0.57
20 0.65
21 0.68
22 0.76
23 0.81
24 0.81
25 0.81
26 0.81
27 0.8
28 0.8
29 0.81
30 0.79
31 0.73
32 0.65
33 0.56
34 0.51
35 0.43
36 0.33
37 0.23
38 0.2
39 0.22
40 0.24
41 0.25
42 0.21
43 0.19
44 0.21
45 0.25
46 0.26
47 0.31
48 0.36
49 0.43
50 0.48
51 0.52
52 0.56
53 0.54
54 0.53
55 0.48
56 0.41
57 0.34
58 0.3
59 0.27
60 0.25
61 0.23
62 0.18
63 0.15
64 0.15
65 0.14
66 0.14
67 0.13
68 0.11
69 0.12
70 0.12
71 0.12
72 0.18
73 0.18
74 0.17
75 0.17
76 0.15
77 0.15
78 0.14
79 0.15
80 0.11
81 0.12
82 0.15
83 0.17
84 0.17
85 0.17
86 0.18
87 0.17
88 0.18
89 0.17
90 0.13
91 0.1
92 0.12
93 0.13
94 0.12
95 0.16
96 0.18
97 0.18