Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0F9WAT8

Protein Details
Accession A0A0F9WAT8    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
67-88RENQMRTVRRERRILRKKRSRIBasic
NLS Segment(s)
PositionSequence
75-88RRERRILRKKRSRI
Subcellular Location(s) nucl 16, mito 10, cyto_nucl 9.5
Family & Domain DBs
Amino Acid Sequences MHVKNICLERKEKELFYKGITYLILKGTSISEKDYCLITRMSNLYKLTTNLAKHALRSIGEAKLLLRENQMRTVRRERRILRKKRSRI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.44
3 0.44
4 0.43
5 0.35
6 0.33
7 0.3
8 0.23
9 0.19
10 0.19
11 0.16
12 0.12
13 0.12
14 0.12
15 0.13
16 0.13
17 0.14
18 0.13
19 0.13
20 0.14
21 0.15
22 0.13
23 0.13
24 0.13
25 0.1
26 0.12
27 0.14
28 0.14
29 0.17
30 0.17
31 0.17
32 0.17
33 0.18
34 0.18
35 0.19
36 0.18
37 0.17
38 0.22
39 0.21
40 0.2
41 0.22
42 0.21
43 0.17
44 0.2
45 0.2
46 0.16
47 0.16
48 0.16
49 0.14
50 0.17
51 0.19
52 0.17
53 0.19
54 0.23
55 0.25
56 0.33
57 0.4
58 0.38
59 0.44
60 0.54
61 0.58
62 0.6
63 0.68
64 0.68
65 0.73
66 0.8
67 0.84
68 0.84