Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F9WV37

Protein Details
Accession A0A0F9WV37   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
32-52QEVQKRIKNKINNVKEKNNIDHydrophilic
163-188EDNKILKKLKLKYGKKKKLNLENITIHydrophilic
NLS Segment(s)
PositionSequence
166-180KILKKLKLKYGKKKK
Subcellular Location(s) nucl 16.5, cyto_nucl 11.5, cyto 5.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR014000  PPV_DNA_helicase_E1_N  
Gene Ontology GO:0016817  F:hydrolase activity, acting on acid anhydrides  
Pfam View protein in Pfam  
PF00524  PPV_E1_N  
Amino Acid Sequences MPLKKINYSKEDAINLYLENYRHKILNELKIQEVQKRIKNKINNVKEKNNIDLIFYKKHLVGFNINKMSDLLSTECTNIIEKSSNKNIEKSVTSKCDTNKHVQCNLDINKKSKLNKYLDLEAECSSNESENSDEDAKSDISIIDNQEIYIEENKLFYEQKEKEDNKILKKLKLKYGKKKKLNLENITISIDDSEEKEEKFSEIDLDVEGVKFIKKDYEFVKEENNEVYKTELEFSNLDTLTKNNSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.31
3 0.28
4 0.26
5 0.21
6 0.23
7 0.24
8 0.24
9 0.25
10 0.25
11 0.31
12 0.35
13 0.43
14 0.45
15 0.45
16 0.46
17 0.5
18 0.52
19 0.49
20 0.49
21 0.47
22 0.47
23 0.52
24 0.56
25 0.58
26 0.64
27 0.69
28 0.72
29 0.75
30 0.8
31 0.79
32 0.81
33 0.8
34 0.76
35 0.69
36 0.65
37 0.54
38 0.46
39 0.44
40 0.4
41 0.36
42 0.34
43 0.32
44 0.26
45 0.29
46 0.28
47 0.26
48 0.3
49 0.33
50 0.4
51 0.42
52 0.41
53 0.38
54 0.37
55 0.34
56 0.25
57 0.21
58 0.14
59 0.12
60 0.13
61 0.13
62 0.13
63 0.13
64 0.13
65 0.12
66 0.12
67 0.14
68 0.15
69 0.21
70 0.28
71 0.35
72 0.35
73 0.37
74 0.37
75 0.36
76 0.37
77 0.34
78 0.33
79 0.3
80 0.3
81 0.31
82 0.33
83 0.37
84 0.38
85 0.44
86 0.45
87 0.45
88 0.49
89 0.46
90 0.45
91 0.45
92 0.47
93 0.46
94 0.42
95 0.39
96 0.41
97 0.44
98 0.47
99 0.45
100 0.48
101 0.43
102 0.46
103 0.47
104 0.46
105 0.44
106 0.41
107 0.37
108 0.29
109 0.25
110 0.19
111 0.16
112 0.11
113 0.09
114 0.08
115 0.07
116 0.07
117 0.07
118 0.1
119 0.1
120 0.1
121 0.1
122 0.11
123 0.1
124 0.1
125 0.1
126 0.07
127 0.07
128 0.09
129 0.09
130 0.09
131 0.09
132 0.09
133 0.09
134 0.09
135 0.1
136 0.1
137 0.1
138 0.09
139 0.09
140 0.09
141 0.11
142 0.11
143 0.1
144 0.17
145 0.18
146 0.23
147 0.32
148 0.34
149 0.36
150 0.45
151 0.5
152 0.47
153 0.55
154 0.54
155 0.51
156 0.57
157 0.59
158 0.59
159 0.64
160 0.68
161 0.7
162 0.78
163 0.82
164 0.83
165 0.86
166 0.86
167 0.86
168 0.87
169 0.81
170 0.77
171 0.7
172 0.62
173 0.55
174 0.46
175 0.35
176 0.25
177 0.19
178 0.13
179 0.1
180 0.12
181 0.12
182 0.13
183 0.14
184 0.14
185 0.14
186 0.14
187 0.14
188 0.11
189 0.1
190 0.11
191 0.1
192 0.1
193 0.1
194 0.09
195 0.09
196 0.08
197 0.08
198 0.08
199 0.08
200 0.14
201 0.15
202 0.19
203 0.23
204 0.31
205 0.33
206 0.35
207 0.44
208 0.38
209 0.4
210 0.41
211 0.4
212 0.32
213 0.3
214 0.3
215 0.23
216 0.22
217 0.23
218 0.18
219 0.18
220 0.18
221 0.2
222 0.24
223 0.22
224 0.22
225 0.2
226 0.2