Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F9WK27

Protein Details
Accession A0A0F9WK27   
Localization Confidence Medium
Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
85-108WHVLKVKVGKRKPKNLKELKEYVEHydrophilic
NLS Segment(s)
PositionSequence
93-98GKRKPK
Subcellular Location(s) nucl 17.5, cyto_nucl 12.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036397  RNaseH_sf  
IPR038717  Tc1-like_DDE_dom  
Gene Ontology GO:0003676  F:nucleic acid binding  
Pfam View protein in Pfam  
PF13358  DDE_3  
Amino Acid Sequences MFFEYRYRNICIIDDILNSEVYCRILDTHLVPSVKKFKLKNYIFQQNNDPKHTSNCTRDHLSDKNILTLDWPEQSPDMNSIENLWHVLKVKVGKRKPKNLKELKEYVEEGWNKIDVDVSKKLVKSRNSKFNELLRVK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.21
3 0.2
4 0.19
5 0.17
6 0.15
7 0.14
8 0.12
9 0.11
10 0.09
11 0.1
12 0.1
13 0.12
14 0.14
15 0.16
16 0.2
17 0.21
18 0.21
19 0.25
20 0.32
21 0.33
22 0.37
23 0.35
24 0.38
25 0.48
26 0.51
27 0.55
28 0.55
29 0.63
30 0.6
31 0.6
32 0.62
33 0.6
34 0.62
35 0.56
36 0.49
37 0.4
38 0.42
39 0.45
40 0.41
41 0.39
42 0.39
43 0.4
44 0.41
45 0.41
46 0.42
47 0.4
48 0.37
49 0.36
50 0.32
51 0.3
52 0.26
53 0.24
54 0.2
55 0.17
56 0.15
57 0.11
58 0.1
59 0.08
60 0.08
61 0.09
62 0.09
63 0.1
64 0.1
65 0.09
66 0.09
67 0.09
68 0.09
69 0.09
70 0.1
71 0.08
72 0.08
73 0.09
74 0.1
75 0.12
76 0.17
77 0.23
78 0.31
79 0.38
80 0.47
81 0.55
82 0.66
83 0.74
84 0.77
85 0.82
86 0.83
87 0.85
88 0.82
89 0.8
90 0.73
91 0.67
92 0.59
93 0.5
94 0.47
95 0.4
96 0.34
97 0.29
98 0.26
99 0.22
100 0.2
101 0.22
102 0.15
103 0.2
104 0.23
105 0.25
106 0.28
107 0.3
108 0.36
109 0.4
110 0.47
111 0.51
112 0.57
113 0.64
114 0.66
115 0.71
116 0.71
117 0.72