Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F9Z6M9

Protein Details
Accession A0A0F9Z6M9    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
26-55RSLTIHLQRRVKKSKKKKDIKDLRNFKNKIBasic
NLS Segment(s)
PositionSequence
34-47RRVKKSKKKKDIKD
Subcellular Location(s) nucl 19, cyto_nucl 13, cyto 5
Family & Domain DBs
Amino Acid Sequences MKTQVREVLQHHKTGEVLLADVLRERSLTIHLQRRVKKSKKKKDIKDLRNFKNKIEGQVLGDVLVPKNLDKDKEFLLNNDIYAKKKVVEKDVVDEVIITGCNLDANKELTCNIKEVKKSEY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.29
3 0.19
4 0.16
5 0.12
6 0.12
7 0.1
8 0.12
9 0.12
10 0.09
11 0.09
12 0.08
13 0.08
14 0.11
15 0.17
16 0.22
17 0.3
18 0.37
19 0.45
20 0.51
21 0.59
22 0.67
23 0.71
24 0.75
25 0.77
26 0.82
27 0.85
28 0.89
29 0.9
30 0.91
31 0.92
32 0.92
33 0.92
34 0.9
35 0.88
36 0.88
37 0.79
38 0.68
39 0.67
40 0.58
41 0.51
42 0.43
43 0.35
44 0.26
45 0.27
46 0.26
47 0.16
48 0.15
49 0.12
50 0.09
51 0.09
52 0.07
53 0.06
54 0.09
55 0.1
56 0.11
57 0.12
58 0.14
59 0.16
60 0.21
61 0.22
62 0.19
63 0.22
64 0.21
65 0.2
66 0.22
67 0.22
68 0.19
69 0.2
70 0.2
71 0.18
72 0.23
73 0.26
74 0.27
75 0.33
76 0.32
77 0.35
78 0.38
79 0.35
80 0.31
81 0.27
82 0.22
83 0.16
84 0.14
85 0.09
86 0.05
87 0.05
88 0.06
89 0.06
90 0.08
91 0.09
92 0.12
93 0.12
94 0.13
95 0.15
96 0.18
97 0.2
98 0.22
99 0.24
100 0.28
101 0.32