Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0F9WCG6

Protein Details
Accession A0A0F9WCG6    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
25-44VDGNKHTKYRLKRKVGPFILHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 15, nucl 13, cyto 11
Family & Domain DBs
Amino Acid Sequences MRLTIKSQEEYDNIVNILKGEDTTVDGNKHTKYRLKRKVGPFILINNLLYLKDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.19
3 0.15
4 0.14
5 0.08
6 0.07
7 0.06
8 0.06
9 0.07
10 0.09
11 0.1
12 0.1
13 0.11
14 0.13
15 0.14
16 0.16
17 0.17
18 0.22
19 0.3
20 0.41
21 0.51
22 0.58
23 0.65
24 0.72
25 0.8
26 0.78
27 0.73
28 0.65
29 0.59
30 0.56
31 0.49
32 0.41
33 0.31
34 0.28