Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0F9YMV0

Protein Details
Accession A0A0F9YMV0    Localization Confidence High Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
7-38TNTNSKGKAKKGTQKKPGQKEQKTKERRSFSIHydrophilic
NLS Segment(s)
PositionSequence
12-57KGKAKKGTQKKPGQKEQKTKERRSFSIRKPNITASQSAKKTTKKPR
Subcellular Location(s) nucl 18, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR007125  Histone_H2A/H2B/H3  
IPR000164  Histone_H3/CENP-A  
Gene Ontology GO:0000786  C:nucleosome  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0030527  F:structural constituent of chromatin  
Pfam View protein in Pfam  
PF00125  Histone  
Amino Acid Sequences MARTAMTNTNSKGKAKKGTQKKPGQKEQKTKERRSFSIRKPNITASQSAKKTTKKPRSIVLKEIRFYQKSTNFLVSKSPFTRMVRDII
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.54
3 0.61
4 0.64
5 0.71
6 0.77
7 0.82
8 0.86
9 0.87
10 0.88
11 0.89
12 0.88
13 0.88
14 0.87
15 0.88
16 0.87
17 0.86
18 0.85
19 0.81
20 0.75
21 0.74
22 0.73
23 0.72
24 0.73
25 0.68
26 0.63
27 0.59
28 0.58
29 0.55
30 0.47
31 0.41
32 0.35
33 0.39
34 0.36
35 0.37
36 0.38
37 0.37
38 0.44
39 0.52
40 0.57
41 0.57
42 0.59
43 0.64
44 0.7
45 0.7
46 0.72
47 0.71
48 0.67
49 0.6
50 0.64
51 0.62
52 0.53
53 0.5
54 0.49
55 0.45
56 0.42
57 0.45
58 0.46
59 0.4
60 0.39
61 0.45
62 0.4
63 0.41
64 0.4
65 0.4
66 0.39
67 0.41
68 0.46