Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0F9WNY9

Protein Details
Accession A0A0F9WNY9    Localization Confidence Low Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
2-29KQCFIYYYLKKNNYKKMLKKIRKLIDLRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, nucl 6
Family & Domain DBs
Amino Acid Sequences MKQCFIYYYLKKNNYKKMLKKIRKLIDLRHHYVINSFIEKYYKFGSYPSGQDTITFFLLLFINFQF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.8
3 0.79
4 0.8
5 0.83
6 0.84
7 0.85
8 0.85
9 0.83
10 0.82
11 0.76
12 0.74
13 0.73
14 0.71
15 0.67
16 0.6
17 0.52
18 0.43
19 0.41
20 0.34
21 0.25
22 0.19
23 0.15
24 0.12
25 0.14
26 0.14
27 0.15
28 0.15
29 0.15
30 0.13
31 0.14
32 0.19
33 0.2
34 0.22
35 0.24
36 0.24
37 0.22
38 0.23
39 0.24
40 0.22
41 0.2
42 0.17
43 0.13
44 0.13
45 0.14
46 0.13