Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F9WJ26

Protein Details
Accession A0A0F9WJ26    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
6-30HDTTNVKKGKIMKKKKNDKESVLNFHydrophilic
NLS Segment(s)
PositionSequence
12-21KKGKIMKKKK
Subcellular Location(s) nucl 13.5, cyto_nucl 10.333, mito_nucl 10.333, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR031492  DUF5101  
Pfam View protein in Pfam  
PF17031  DUF5101  
Amino Acid Sequences MRNILHDTTNVKKGKIMKKKKNDKESVLNFIKDVYNTTTDYNLKYDLSKCIEIIEGKENQEIKDLKEALEEVIQENNELIEEKTKLYLELEDAKNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.56
3 0.61
4 0.63
5 0.73
6 0.84
7 0.9
8 0.92
9 0.89
10 0.85
11 0.85
12 0.8
13 0.78
14 0.71
15 0.61
16 0.5
17 0.43
18 0.37
19 0.26
20 0.23
21 0.16
22 0.14
23 0.15
24 0.16
25 0.17
26 0.17
27 0.18
28 0.17
29 0.16
30 0.14
31 0.14
32 0.15
33 0.15
34 0.18
35 0.17
36 0.16
37 0.15
38 0.16
39 0.15
40 0.16
41 0.16
42 0.14
43 0.15
44 0.18
45 0.18
46 0.17
47 0.22
48 0.21
49 0.19
50 0.24
51 0.23
52 0.21
53 0.21
54 0.21
55 0.17
56 0.18
57 0.16
58 0.1
59 0.13
60 0.13
61 0.11
62 0.11
63 0.1
64 0.09
65 0.09
66 0.09
67 0.1
68 0.11
69 0.12
70 0.14
71 0.15
72 0.15
73 0.15
74 0.16
75 0.16
76 0.25