Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0F9YM96

Protein Details
Accession A0A0F9YM96    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
45-65KGTIERSKRFGRKKKLQLMMLHydrophilic
NLS Segment(s)
PositionSequence
44-59EKGTIERSKRFGRKKK
Subcellular Location(s) nucl 15, mito 10, cyto_nucl 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000835  HTH_MarR-typ  
IPR036388  WH-like_DNA-bd_sf  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF01047  MarR  
Amino Acid Sequences MQSTLKGKIEILLLSNKKMPQVEIARKFKILQSTIFKIVKNMKEKGTIERSKRFGRKKKLQLMMLQLYLKLIKKPKTSLRNLSIKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.3
3 0.28
4 0.29
5 0.29
6 0.27
7 0.26
8 0.34
9 0.41
10 0.47
11 0.53
12 0.51
13 0.52
14 0.52
15 0.46
16 0.43
17 0.35
18 0.31
19 0.31
20 0.33
21 0.39
22 0.39
23 0.37
24 0.34
25 0.38
26 0.39
27 0.38
28 0.36
29 0.32
30 0.36
31 0.37
32 0.39
33 0.42
34 0.42
35 0.43
36 0.47
37 0.5
38 0.53
39 0.6
40 0.64
41 0.64
42 0.69
43 0.74
44 0.78
45 0.83
46 0.82
47 0.79
48 0.74
49 0.72
50 0.66
51 0.59
52 0.49
53 0.39
54 0.32
55 0.31
56 0.27
57 0.24
58 0.27
59 0.3
60 0.35
61 0.43
62 0.52
63 0.59
64 0.67
65 0.72
66 0.74