Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F9WQE5

Protein Details
Accession A0A0F9WQE5    Localization Confidence Low Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
80-114LECQCKCGNIKRYKLNKNNKRCKLNKNGNVTKQINHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007175  Rpr2/Snm1/Rpp21  
Gene Ontology GO:1902555  C:endoribonuclease complex  
GO:1990904  C:ribonucleoprotein complex  
GO:0034470  P:ncRNA processing  
Pfam View protein in Pfam  
PF04032  Rpr2  
Amino Acid Sequences MKNRKNKNTVQKLIFLFNMALVYRNLDIHKNLIKRMFLVAKKFLIKIPPSIKRSVCGKCFKLRITNGSSKIVDIRNEKYLECQCKCGNIKRYKLNKNNKRCKLNKNGNVTKQINDISLNVSNN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.46
3 0.35
4 0.26
5 0.23
6 0.16
7 0.15
8 0.11
9 0.13
10 0.12
11 0.14
12 0.14
13 0.15
14 0.16
15 0.2
16 0.26
17 0.26
18 0.29
19 0.3
20 0.3
21 0.28
22 0.32
23 0.34
24 0.31
25 0.33
26 0.33
27 0.33
28 0.34
29 0.34
30 0.31
31 0.29
32 0.27
33 0.3
34 0.34
35 0.39
36 0.4
37 0.44
38 0.43
39 0.41
40 0.47
41 0.45
42 0.44
43 0.43
44 0.43
45 0.44
46 0.48
47 0.46
48 0.46
49 0.43
50 0.41
51 0.4
52 0.44
53 0.4
54 0.4
55 0.38
56 0.31
57 0.33
58 0.3
59 0.27
60 0.24
61 0.24
62 0.25
63 0.26
64 0.26
65 0.28
66 0.33
67 0.37
68 0.35
69 0.37
70 0.33
71 0.4
72 0.44
73 0.48
74 0.51
75 0.51
76 0.58
77 0.63
78 0.73
79 0.75
80 0.81
81 0.84
82 0.84
83 0.86
84 0.9
85 0.89
86 0.9
87 0.87
88 0.87
89 0.87
90 0.88
91 0.85
92 0.85
93 0.85
94 0.81
95 0.83
96 0.76
97 0.67
98 0.61
99 0.54
100 0.45
101 0.37
102 0.31
103 0.26