Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0F9WAT2

Protein Details
Accession A0A0F9WAT2    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
108-153DKKIKRKETVCKNREERKDSKNNGFRKQSDKKFRGDRKSYTKKFGGBasic
NLS Segment(s)
PositionSequence
101-161EKKKEAEDKKIKRKETVCKNREERKDSKNNGFRKQSDKKFRGDRKSYTKKFGGGNKFRSRK
Subcellular Location(s) mito 12.5, mito_nucl 12.5, nucl 11.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038664  Gar1/Naf1_Cbf5-bd_sf  
IPR007504  H/ACA_rnp_Gar1/Naf1  
IPR009000  Transl_B-barrel_sf  
Gene Ontology GO:0005730  C:nucleolus  
GO:1990904  C:ribonucleoprotein complex  
GO:0003723  F:RNA binding  
GO:0001522  P:pseudouridine synthesis  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF04410  Gar1  
Amino Acid Sequences MKKNFRDRRQTDANATLVNLGTFIHKCGQLFVLKLVTDGIPFPNAFVFDKNKKQIGKVEEIFGPQTDVYIAISLEKESNEFFIYSNKLIPKNRFLERSETEKKKEAEDKKIKRKETVCKNREERKDSKNNGFRKQSDKKFRGDRKSYTKKFGGGNKFRSRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.47
3 0.4
4 0.3
5 0.23
6 0.16
7 0.1
8 0.11
9 0.11
10 0.12
11 0.14
12 0.15
13 0.15
14 0.17
15 0.19
16 0.19
17 0.19
18 0.19
19 0.19
20 0.18
21 0.18
22 0.17
23 0.15
24 0.13
25 0.12
26 0.11
27 0.1
28 0.1
29 0.1
30 0.1
31 0.11
32 0.12
33 0.14
34 0.19
35 0.23
36 0.31
37 0.35
38 0.39
39 0.38
40 0.4
41 0.44
42 0.42
43 0.44
44 0.38
45 0.37
46 0.33
47 0.33
48 0.31
49 0.24
50 0.2
51 0.12
52 0.1
53 0.08
54 0.07
55 0.06
56 0.05
57 0.05
58 0.05
59 0.05
60 0.05
61 0.06
62 0.06
63 0.06
64 0.06
65 0.07
66 0.07
67 0.07
68 0.07
69 0.08
70 0.11
71 0.11
72 0.13
73 0.15
74 0.19
75 0.23
76 0.25
77 0.3
78 0.33
79 0.36
80 0.38
81 0.37
82 0.4
83 0.4
84 0.45
85 0.48
86 0.48
87 0.47
88 0.49
89 0.49
90 0.47
91 0.52
92 0.5
93 0.52
94 0.58
95 0.65
96 0.69
97 0.76
98 0.73
99 0.72
100 0.73
101 0.72
102 0.73
103 0.74
104 0.68
105 0.7
106 0.77
107 0.79
108 0.8
109 0.77
110 0.73
111 0.72
112 0.77
113 0.74
114 0.76
115 0.75
116 0.74
117 0.76
118 0.77
119 0.71
120 0.7
121 0.74
122 0.74
123 0.77
124 0.73
125 0.73
126 0.76
127 0.81
128 0.82
129 0.79
130 0.79
131 0.79
132 0.86
133 0.83
134 0.81
135 0.76
136 0.7
137 0.69
138 0.69
139 0.69
140 0.67
141 0.71