Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F9ZBV0

Protein Details
Accession A0A0F9ZBV0   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
6-29LYLKVNFYKYKKIKRPMHKFSIIFHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 13, mito 7, E.R. 3, golg 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MTQHILYLKVNFYKYKKIKRPMHKFSIIFWISFIYSLKIISVVPQKFKMYEIDLRSSSPV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.56
3 0.62
4 0.68
5 0.75
6 0.8
7 0.88
8 0.86
9 0.85
10 0.82
11 0.74
12 0.65
13 0.65
14 0.54
15 0.43
16 0.34
17 0.27
18 0.18
19 0.18
20 0.16
21 0.08
22 0.07
23 0.07
24 0.07
25 0.07
26 0.07
27 0.1
28 0.18
29 0.19
30 0.23
31 0.26
32 0.28
33 0.28
34 0.3
35 0.29
36 0.27
37 0.32
38 0.33
39 0.36
40 0.35