Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F9YN79

Protein Details
Accession A0A0F9YN79   
Localization Confidence Low
Confidence Score 6.4
NoLS Segment(s)
PositionSequenceProtein Nature
177-202EIDAVRKKSWQQKGFKKENNRKIECFHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 16, cyto_nucl 11.5, nucl 5, mito 2, pero 2
Family & Domain DBs
Amino Acid Sequences MFNTTNMATYDKIFLQLRNEEKDDPQQFIEDLLEVGRLNELGEGKLILMFKMSLGEEAKDWMVAQPLGLSFEEILKSFGMIFVSNIALKASTDKLSTLKFAGGSILNYLDRMARKGIVPEDVLIALVLKKLPCNLANIVLVNNKDGLSWEYLYRALRNVKTVEEPRYMEVSSGAPMEIDAVRKKSWQQKGFKKENNRKIECFICGQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.26
3 0.33
4 0.36
5 0.39
6 0.42
7 0.39
8 0.41
9 0.49
10 0.46
11 0.41
12 0.36
13 0.32
14 0.29
15 0.27
16 0.24
17 0.15
18 0.12
19 0.09
20 0.09
21 0.08
22 0.08
23 0.07
24 0.06
25 0.06
26 0.08
27 0.08
28 0.08
29 0.08
30 0.08
31 0.08
32 0.1
33 0.1
34 0.08
35 0.08
36 0.07
37 0.07
38 0.09
39 0.09
40 0.09
41 0.1
42 0.11
43 0.1
44 0.12
45 0.12
46 0.1
47 0.1
48 0.08
49 0.09
50 0.08
51 0.08
52 0.07
53 0.08
54 0.09
55 0.09
56 0.09
57 0.07
58 0.08
59 0.09
60 0.08
61 0.09
62 0.07
63 0.07
64 0.07
65 0.07
66 0.07
67 0.06
68 0.06
69 0.06
70 0.07
71 0.07
72 0.07
73 0.06
74 0.06
75 0.05
76 0.07
77 0.08
78 0.08
79 0.09
80 0.09
81 0.11
82 0.12
83 0.13
84 0.12
85 0.11
86 0.1
87 0.09
88 0.1
89 0.08
90 0.08
91 0.07
92 0.08
93 0.07
94 0.07
95 0.07
96 0.08
97 0.08
98 0.09
99 0.09
100 0.09
101 0.1
102 0.12
103 0.13
104 0.13
105 0.13
106 0.12
107 0.12
108 0.11
109 0.1
110 0.08
111 0.07
112 0.05
113 0.05
114 0.06
115 0.05
116 0.06
117 0.07
118 0.1
119 0.1
120 0.14
121 0.15
122 0.17
123 0.18
124 0.18
125 0.19
126 0.19
127 0.18
128 0.15
129 0.15
130 0.12
131 0.1
132 0.11
133 0.11
134 0.11
135 0.12
136 0.12
137 0.13
138 0.15
139 0.16
140 0.16
141 0.19
142 0.22
143 0.22
144 0.26
145 0.26
146 0.26
147 0.33
148 0.37
149 0.37
150 0.36
151 0.37
152 0.35
153 0.37
154 0.34
155 0.27
156 0.24
157 0.19
158 0.16
159 0.14
160 0.11
161 0.08
162 0.08
163 0.1
164 0.1
165 0.13
166 0.15
167 0.18
168 0.19
169 0.22
170 0.29
171 0.37
172 0.46
173 0.51
174 0.58
175 0.65
176 0.75
177 0.83
178 0.85
179 0.87
180 0.88
181 0.89
182 0.9
183 0.86
184 0.79
185 0.75
186 0.71