Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F9YT06

Protein Details
Accession A0A0F9YT06    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MEIDDRKKNKKINIVKLPKFLGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 11.5, cyto 4.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR003196  TFIIF_beta  
IPR040450  TFIIF_beta_HTH  
IPR011039  TFIIF_interaction  
IPR036388  WH-like_DNA-bd_sf  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:0005674  C:transcription factor TFIIF complex  
GO:0003677  F:DNA binding  
GO:0003743  F:translation initiation factor activity  
GO:0006367  P:transcription initiation at RNA polymerase II promoter  
Pfam View protein in Pfam  
PF02270  TFIIF_beta  
Amino Acid Sequences MEIDDRKKNKKINIVKLPKFLGNYITNLHQQTDIGEVDISDNGNIKFRIYDKSGIGIPLEYNVKQISKNNSDMYVLSNTQILSSIEGEIDSELVVTPIINKKYIEFKKQNAYKVPSTTAIIDSTTEKIRLEKIGNLREMDYLARKRKQMLIDKKRERLDKTEAMNIVFNAFEKYESWTVRDLADFTGQPTAFVQEIVNEICNVDKKEHKSLYTLKNEYK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.81
3 0.81
4 0.77
5 0.7
6 0.62
7 0.52
8 0.47
9 0.39
10 0.35
11 0.3
12 0.3
13 0.31
14 0.3
15 0.3
16 0.24
17 0.21
18 0.19
19 0.2
20 0.17
21 0.13
22 0.11
23 0.1
24 0.11
25 0.11
26 0.11
27 0.08
28 0.1
29 0.1
30 0.13
31 0.13
32 0.13
33 0.14
34 0.15
35 0.2
36 0.21
37 0.25
38 0.23
39 0.25
40 0.26
41 0.24
42 0.23
43 0.18
44 0.15
45 0.14
46 0.15
47 0.12
48 0.13
49 0.13
50 0.14
51 0.16
52 0.21
53 0.25
54 0.28
55 0.32
56 0.32
57 0.32
58 0.32
59 0.3
60 0.28
61 0.23
62 0.19
63 0.15
64 0.14
65 0.13
66 0.12
67 0.13
68 0.1
69 0.08
70 0.09
71 0.08
72 0.07
73 0.07
74 0.07
75 0.06
76 0.06
77 0.04
78 0.03
79 0.03
80 0.03
81 0.03
82 0.03
83 0.05
84 0.09
85 0.1
86 0.11
87 0.11
88 0.13
89 0.23
90 0.27
91 0.33
92 0.33
93 0.36
94 0.45
95 0.49
96 0.52
97 0.48
98 0.5
99 0.44
100 0.42
101 0.4
102 0.32
103 0.28
104 0.25
105 0.2
106 0.16
107 0.13
108 0.12
109 0.11
110 0.11
111 0.11
112 0.11
113 0.1
114 0.1
115 0.12
116 0.14
117 0.14
118 0.17
119 0.23
120 0.28
121 0.3
122 0.3
123 0.29
124 0.27
125 0.26
126 0.23
127 0.22
128 0.24
129 0.29
130 0.32
131 0.32
132 0.34
133 0.39
134 0.45
135 0.5
136 0.54
137 0.58
138 0.65
139 0.72
140 0.77
141 0.78
142 0.76
143 0.69
144 0.64
145 0.61
146 0.57
147 0.53
148 0.52
149 0.47
150 0.42
151 0.39
152 0.33
153 0.26
154 0.19
155 0.16
156 0.11
157 0.1
158 0.09
159 0.09
160 0.14
161 0.18
162 0.19
163 0.21
164 0.21
165 0.22
166 0.22
167 0.23
168 0.19
169 0.16
170 0.19
171 0.17
172 0.16
173 0.21
174 0.2
175 0.2
176 0.19
177 0.19
178 0.16
179 0.16
180 0.15
181 0.1
182 0.13
183 0.13
184 0.14
185 0.11
186 0.11
187 0.14
188 0.18
189 0.19
190 0.21
191 0.27
192 0.32
193 0.42
194 0.47
195 0.46
196 0.48
197 0.56
198 0.61
199 0.64