FuNGI

A0A0F9WSV1

Protein Details

Accession

A0A0F9WSV1

Localization Confidence

Medium

Confidence Score

12.1

NoLS Segment(s)

Position	Sequence	Protein Nature
438-463	KKFPKEFKEENIKRIKRKPKSKKKLK	Basic

NLS Segment(s)

Position	Sequence
439-463	KFPKEFKEENIKRIKRKPKSKKKLK

Subcellular Location(s)

nucl 16.5, cyto_nucl 14.5, cyto 9.5

Family & Domain DBs

InterPro	View protein in InterPro IPR011545 DEAD/DEAH_box_helicase_dom IPR025313 DUF4217 IPR014001 Helicase_ATP-bd IPR001650 Helicase_C IPR027417 P-loop_NTPase IPR000629 RNA-helicase_DEAD-box_CS
Gene Ontology	GO:0005730 C:nucleolus GO:0005524 F:ATP binding GO:0016887 F:ATP hydrolysis activity GO:0004386 F:helicase activity GO:0003723 F:RNA binding GO:0006364 P:rRNA processing
Pfam	View protein in Pfam PF00270 DEAD PF13959 DUF4217 PF00271 Helicase_C
PROSITE	View protein in PROSITE PS00039 DEAD_ATP_HELICASE PS51192 HELICASE_ATP_BIND_1 PS51194 HELICASE_CTER
CDD	cd00268 DEADc cd18787 SF2_C_DEAD

Amino Acid Sequences

MSDPVKFIDTHLNTIIKEVLQKNNYVYMTDVQQKTLPHMLNNKDVVVQSQTGSGKTLSFVLPIIHNYLKQITFYKDFSVCIVITPTRELALQITDVFKMFNVPTKCFIGGLDIDDDLIEITKDYKIIVGTPGRLLEVIKLNTKLFSRLSYLVLDEADKLIDLGFKEKVLNIVSFLPKSKSCGFFSATINENVKNLSKLILKNPIFVKSEGSEIPNKLKICYLKTKYSDKLLTTLDLIKNKKSIVFFATCNQVDFFYKFLIKFNIKNVYKIHRKMKQEDRTNVYKDFFEKGDILLCTDIAARGIDFKNIELVIHFDIPKDYTNIVHRSGRTARNGKEGESILFVLPNELVYLDFIKIKNIEIEEITCTPSYKLDFLKTFMDDELLELSVKAFVSYFRSYKEHTLNYILDYTTLDYDDLVELYMLKKIPGMTELRNVEFKKFPKEFKEENIKRIKRKPKSKKKLK

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.35
2	0.34
3	0.25
4	0.3
5	0.3
6	0.35
7	0.34
8	0.37
9	0.37
10	0.42
11	0.41
12	0.35
13	0.33
14	0.26
15	0.3
16	0.36
17	0.35
18	0.3
19	0.32
20	0.32
21	0.34
22	0.39
23	0.35
24	0.32
25	0.39
26	0.42
27	0.46
28	0.48
29	0.43
30	0.39
31	0.37
32	0.34
33	0.29
34	0.26
35	0.19
36	0.23
37	0.23
38	0.21
39	0.22
40	0.2
41	0.17
42	0.16
43	0.18
44	0.13
45	0.12
46	0.13
47	0.13
48	0.14
49	0.15
50	0.2
51	0.19
52	0.19
53	0.2
54	0.24
55	0.23
56	0.23
57	0.26
58	0.26
59	0.28
60	0.29
61	0.32
62	0.28
63	0.28
64	0.27
65	0.27
66	0.22
67	0.18
68	0.21
69	0.17
70	0.17
71	0.19
72	0.18
73	0.15
74	0.15
75	0.14
76	0.12
77	0.13
78	0.12
79	0.12
80	0.13
81	0.12
82	0.12
83	0.12
84	0.1
85	0.12
86	0.11
87	0.17
88	0.19
89	0.21
90	0.25
91	0.28
92	0.28
93	0.25
94	0.24
95	0.21
96	0.19
97	0.18
98	0.16
99	0.13
100	0.12
101	0.12
102	0.12
103	0.08
104	0.07
105	0.05
106	0.04
107	0.05
108	0.05
109	0.06
110	0.06
111	0.07
112	0.07
113	0.09
114	0.14
115	0.15
116	0.16
117	0.17
118	0.18
119	0.17
120	0.17
121	0.16
122	0.14
123	0.18
124	0.18
125	0.2
126	0.22
127	0.22
128	0.24
129	0.24
130	0.24
131	0.19
132	0.19
133	0.2
134	0.2
135	0.21
136	0.2
137	0.2
138	0.17
139	0.16
140	0.15
141	0.11
142	0.09
143	0.08
144	0.06
145	0.06
146	0.05
147	0.06
148	0.06
149	0.08
150	0.08
151	0.09
152	0.09
153	0.1
154	0.12
155	0.12
156	0.12
157	0.12
158	0.15
159	0.16
160	0.17
161	0.18
162	0.18
163	0.17
164	0.21
165	0.24
166	0.25
167	0.25
168	0.27
169	0.28
170	0.29
171	0.31
172	0.3
173	0.28
174	0.27
175	0.26
176	0.24
177	0.21
178	0.19
179	0.18
180	0.14
181	0.12
182	0.12
183	0.15
184	0.16
185	0.19
186	0.28
187	0.27
188	0.31
189	0.33
190	0.35
191	0.33
192	0.31
193	0.3
194	0.21
195	0.23
196	0.19
197	0.2
198	0.18
199	0.17
200	0.2
201	0.22
202	0.21
203	0.2
204	0.22
205	0.22
206	0.24
207	0.32
208	0.34
209	0.36
210	0.4
211	0.46
212	0.45
213	0.48
214	0.47
215	0.37
216	0.36
217	0.3
218	0.26
219	0.22
220	0.24
221	0.21
222	0.23
223	0.24
224	0.21
225	0.22
226	0.22
227	0.23
228	0.2
229	0.18
230	0.17
231	0.18
232	0.18
233	0.19
234	0.25
235	0.22
236	0.22
237	0.21
238	0.18
239	0.17
240	0.17
241	0.15
242	0.1
243	0.12
244	0.12
245	0.13
246	0.17
247	0.18
248	0.2
249	0.24
250	0.32
251	0.31
252	0.34
253	0.36
254	0.39
255	0.45
256	0.5
257	0.54
258	0.51
259	0.56
260	0.61
261	0.69
262	0.7
263	0.71
264	0.71
265	0.69
266	0.68
267	0.66
268	0.6
269	0.5
270	0.42
271	0.34
272	0.3
273	0.24
274	0.19
275	0.17
276	0.14
277	0.17
278	0.15
279	0.14
280	0.12
281	0.11
282	0.1
283	0.09
284	0.09
285	0.06
286	0.06
287	0.05
288	0.09
289	0.1
290	0.11
291	0.11
292	0.11
293	0.13
294	0.13
295	0.13
296	0.09
297	0.11
298	0.11
299	0.13
300	0.13
301	0.11
302	0.12
303	0.13
304	0.14
305	0.14
306	0.12
307	0.13
308	0.19
309	0.22
310	0.25
311	0.28
312	0.27
313	0.31
314	0.37
315	0.4
316	0.43
317	0.47
318	0.46
319	0.51
320	0.52
321	0.47
322	0.46
323	0.41
324	0.34
325	0.28
326	0.27
327	0.18
328	0.18
329	0.16
330	0.12
331	0.1
332	0.09
333	0.07
334	0.06
335	0.06
336	0.06
337	0.08
338	0.08
339	0.11
340	0.11
341	0.14
342	0.14
343	0.15
344	0.17
345	0.16
346	0.17
347	0.15
348	0.16
349	0.17
350	0.18
351	0.19
352	0.16
353	0.16
354	0.15
355	0.17
356	0.17
357	0.17
358	0.19
359	0.24
360	0.25
361	0.27
362	0.3
363	0.29
364	0.28
365	0.25
366	0.24
367	0.17
368	0.16
369	0.15
370	0.12
371	0.11
372	0.09
373	0.09
374	0.09
375	0.09
376	0.08
377	0.07
378	0.08
379	0.14
380	0.18
381	0.2
382	0.22
383	0.26
384	0.29
385	0.36
386	0.43
387	0.41
388	0.4
389	0.44
390	0.41
391	0.4
392	0.39
393	0.32
394	0.24
395	0.21
396	0.2
397	0.15
398	0.15
399	0.12
400	0.1
401	0.11
402	0.11
403	0.1
404	0.08
405	0.07
406	0.07
407	0.08
408	0.11
409	0.1
410	0.1
411	0.12
412	0.12
413	0.13
414	0.18
415	0.22
416	0.23
417	0.31
418	0.35
419	0.37
420	0.43
421	0.43
422	0.43
423	0.46
424	0.46
425	0.48
426	0.49
427	0.53
428	0.54
429	0.61
430	0.62
431	0.64
432	0.72
433	0.68
434	0.72
435	0.76
436	0.76
437	0.76
438	0.81
439	0.83
440	0.82
441	0.87
442	0.89
443	0.89

A0A0F9WSV1

3D AlphaFold-predicted Structure Viewer