Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F9WFX0

Protein Details
Accession A0A0F9WFX0   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
37-66DDSNDKKDSKKSNKSKKKDGKKSNGCVSSIHydrophilic
NLS Segment(s)
PositionSequence
42-58KKDSKKSNKSKKKDGKK
Subcellular Location(s) extr 7, E.R. 6, plas 5, golg 4, pero 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MQKIFIILASLLTFIVAQTKESSKSGTKGSQDSEDDDDSNDKKDSKKSNKSKKKDGKKSNGCVSSISMFTVCAACLVTALLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.1
3 0.09
4 0.1
5 0.12
6 0.14
7 0.17
8 0.18
9 0.21
10 0.19
11 0.22
12 0.25
13 0.27
14 0.28
15 0.28
16 0.3
17 0.31
18 0.29
19 0.29
20 0.28
21 0.25
22 0.22
23 0.2
24 0.2
25 0.16
26 0.17
27 0.15
28 0.12
29 0.13
30 0.19
31 0.28
32 0.36
33 0.46
34 0.55
35 0.66
36 0.75
37 0.81
38 0.86
39 0.87
40 0.88
41 0.89
42 0.89
43 0.89
44 0.89
45 0.9
46 0.88
47 0.81
48 0.71
49 0.61
50 0.54
51 0.45
52 0.36
53 0.28
54 0.19
55 0.15
56 0.15
57 0.14
58 0.1
59 0.08
60 0.08
61 0.07
62 0.07