Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F9Y5N2

Protein Details
Accession A0A0F9Y5N2    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
42-70ITMKRIVCDYPYRRKKRERKSPSTTNAVVHydrophilic
NLS Segment(s)
PositionSequence
55-61RKKRERK
Subcellular Location(s) nucl 11, mito 10, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007219  Transcription_factor_dom_fun  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0008270  F:zinc ion binding  
GO:0006351  P:DNA-templated transcription  
Pfam View protein in Pfam  
PF04082  Fungal_trans  
CDD cd12148  fungal_TF_MHR  
Amino Acid Sequences MRLWQRRLRHSPVWHAGTPSGDATAPFLSAKAVSSEGSTHLITMKRIVCDYPYRRKKRERKSPSTTNAVVSPTSGLLTDQASATAETSQASPDYDNFHLVPSHSAGANFLTERFLDPEAFNSAQLKVPVPDIDYLITKDISDLVGDVSNIKAISDQFFSSVKEWMPIVSKTQFLANLVSWLTHKRAELFFLILAMKLSCEQVSGPRTPLYQITKYLQFRIEHSGALSLQVIQASVLIAIYEMGHGIYPAAFLSISECARYATALGIDKSIICRELNGVSRNELEERRRVWWAILVLDRFMNLSDPSRHLVTPDPILENILPVDDAAFNNGTCRPEDAYTLGSATALDLGRFARFAQAAHLIGQVLRHVSEEFSESETAQLRRTIFSLVSVSRLEAHLRQLEFCAQTAVCYWYVYLKWSIRLTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.64
3 0.57
4 0.5
5 0.44
6 0.34
7 0.26
8 0.19
9 0.17
10 0.16
11 0.15
12 0.14
13 0.12
14 0.11
15 0.11
16 0.11
17 0.12
18 0.11
19 0.12
20 0.11
21 0.12
22 0.13
23 0.15
24 0.18
25 0.17
26 0.15
27 0.18
28 0.2
29 0.19
30 0.25
31 0.26
32 0.25
33 0.26
34 0.27
35 0.27
36 0.36
37 0.43
38 0.48
39 0.55
40 0.63
41 0.71
42 0.81
43 0.87
44 0.88
45 0.9
46 0.9
47 0.9
48 0.9
49 0.92
50 0.88
51 0.86
52 0.77
53 0.68
54 0.6
55 0.52
56 0.42
57 0.32
58 0.26
59 0.17
60 0.15
61 0.12
62 0.09
63 0.09
64 0.09
65 0.09
66 0.08
67 0.08
68 0.09
69 0.09
70 0.09
71 0.08
72 0.08
73 0.08
74 0.08
75 0.09
76 0.08
77 0.09
78 0.09
79 0.1
80 0.15
81 0.15
82 0.18
83 0.17
84 0.17
85 0.17
86 0.17
87 0.18
88 0.15
89 0.16
90 0.14
91 0.13
92 0.13
93 0.13
94 0.14
95 0.12
96 0.1
97 0.1
98 0.1
99 0.11
100 0.12
101 0.13
102 0.13
103 0.13
104 0.14
105 0.19
106 0.19
107 0.18
108 0.17
109 0.17
110 0.17
111 0.18
112 0.17
113 0.13
114 0.14
115 0.14
116 0.14
117 0.14
118 0.13
119 0.13
120 0.13
121 0.13
122 0.13
123 0.12
124 0.11
125 0.1
126 0.1
127 0.09
128 0.07
129 0.06
130 0.06
131 0.06
132 0.06
133 0.07
134 0.06
135 0.07
136 0.07
137 0.07
138 0.07
139 0.07
140 0.09
141 0.1
142 0.1
143 0.11
144 0.12
145 0.14
146 0.14
147 0.15
148 0.13
149 0.13
150 0.13
151 0.12
152 0.14
153 0.13
154 0.16
155 0.15
156 0.16
157 0.15
158 0.17
159 0.16
160 0.14
161 0.15
162 0.12
163 0.11
164 0.11
165 0.11
166 0.1
167 0.11
168 0.12
169 0.12
170 0.12
171 0.14
172 0.14
173 0.16
174 0.16
175 0.15
176 0.13
177 0.12
178 0.12
179 0.09
180 0.09
181 0.07
182 0.06
183 0.06
184 0.06
185 0.05
186 0.05
187 0.05
188 0.1
189 0.13
190 0.14
191 0.15
192 0.15
193 0.16
194 0.16
195 0.21
196 0.21
197 0.2
198 0.21
199 0.22
200 0.28
201 0.29
202 0.3
203 0.3
204 0.26
205 0.26
206 0.3
207 0.28
208 0.21
209 0.2
210 0.2
211 0.15
212 0.15
213 0.13
214 0.07
215 0.07
216 0.06
217 0.06
218 0.04
219 0.05
220 0.04
221 0.04
222 0.03
223 0.03
224 0.03
225 0.03
226 0.03
227 0.03
228 0.03
229 0.03
230 0.03
231 0.03
232 0.03
233 0.03
234 0.03
235 0.03
236 0.03
237 0.03
238 0.03
239 0.05
240 0.08
241 0.08
242 0.08
243 0.08
244 0.08
245 0.09
246 0.09
247 0.08
248 0.06
249 0.08
250 0.1
251 0.1
252 0.1
253 0.1
254 0.1
255 0.11
256 0.11
257 0.1
258 0.08
259 0.08
260 0.1
261 0.14
262 0.19
263 0.21
264 0.21
265 0.22
266 0.23
267 0.24
268 0.25
269 0.25
270 0.23
271 0.25
272 0.27
273 0.28
274 0.29
275 0.29
276 0.26
277 0.26
278 0.24
279 0.22
280 0.24
281 0.21
282 0.2
283 0.19
284 0.19
285 0.15
286 0.13
287 0.11
288 0.08
289 0.12
290 0.14
291 0.16
292 0.19
293 0.2
294 0.2
295 0.2
296 0.23
297 0.23
298 0.24
299 0.24
300 0.23
301 0.21
302 0.23
303 0.21
304 0.18
305 0.15
306 0.11
307 0.09
308 0.07
309 0.08
310 0.07
311 0.07
312 0.09
313 0.09
314 0.09
315 0.11
316 0.14
317 0.14
318 0.13
319 0.16
320 0.16
321 0.16
322 0.19
323 0.19
324 0.18
325 0.18
326 0.17
327 0.15
328 0.12
329 0.11
330 0.09
331 0.1
332 0.09
333 0.08
334 0.08
335 0.09
336 0.1
337 0.1
338 0.1
339 0.11
340 0.12
341 0.12
342 0.15
343 0.19
344 0.2
345 0.21
346 0.21
347 0.17
348 0.17
349 0.18
350 0.15
351 0.12
352 0.11
353 0.11
354 0.11
355 0.11
356 0.12
357 0.13
358 0.13
359 0.15
360 0.16
361 0.15
362 0.17
363 0.21
364 0.21
365 0.21
366 0.23
367 0.22
368 0.22
369 0.23
370 0.23
371 0.18
372 0.2
373 0.23
374 0.2
375 0.23
376 0.22
377 0.21
378 0.2
379 0.21
380 0.22
381 0.19
382 0.25
383 0.28
384 0.28
385 0.28
386 0.29
387 0.34
388 0.32
389 0.3
390 0.28
391 0.21
392 0.21
393 0.22
394 0.23
395 0.18
396 0.17
397 0.17
398 0.18
399 0.19
400 0.21
401 0.26
402 0.26
403 0.32