Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0S2LIA9

Protein Details
Accession A0A0S2LIA9   
Localization Confidence Low
Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
151-170EKISDRQRNPIKSKGKGKKKBasic
NLS Segment(s)
PositionSequence
158-170RNPIKSKGKGKKK
Subcellular Location(s) mito 23, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR034600  MRPL36_yeast  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Amino Acid Sequences MSSTLFRSSSSALPTTIVTRVRTKTTRASPPSLWLSRTHLKPQPVVPPPIPPTYPMRVILSDGSSFTAYTTAPTPSTKKLTRDVNNNPLWSPASEKKGLGEGEEGRVTRFRKRFEGLSGDIIGGIGVEGETRTDAFALEDLDWMSEGVQEEKISDRQRNPIKSKGKGKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.22
3 0.24
4 0.24
5 0.23
6 0.28
7 0.31
8 0.37
9 0.39
10 0.41
11 0.46
12 0.51
13 0.58
14 0.57
15 0.61
16 0.54
17 0.58
18 0.62
19 0.55
20 0.48
21 0.4
22 0.41
23 0.43
24 0.46
25 0.46
26 0.43
27 0.44
28 0.46
29 0.48
30 0.5
31 0.48
32 0.49
33 0.43
34 0.44
35 0.45
36 0.44
37 0.4
38 0.33
39 0.33
40 0.32
41 0.34
42 0.29
43 0.27
44 0.24
45 0.25
46 0.24
47 0.2
48 0.16
49 0.14
50 0.13
51 0.11
52 0.11
53 0.09
54 0.09
55 0.07
56 0.07
57 0.08
58 0.08
59 0.09
60 0.11
61 0.13
62 0.16
63 0.22
64 0.24
65 0.26
66 0.31
67 0.39
68 0.42
69 0.48
70 0.52
71 0.54
72 0.54
73 0.52
74 0.46
75 0.38
76 0.34
77 0.26
78 0.25
79 0.2
80 0.21
81 0.22
82 0.21
83 0.21
84 0.24
85 0.23
86 0.19
87 0.17
88 0.14
89 0.16
90 0.17
91 0.17
92 0.14
93 0.18
94 0.19
95 0.24
96 0.27
97 0.28
98 0.32
99 0.35
100 0.37
101 0.38
102 0.43
103 0.37
104 0.36
105 0.33
106 0.28
107 0.24
108 0.21
109 0.17
110 0.1
111 0.07
112 0.03
113 0.02
114 0.02
115 0.02
116 0.03
117 0.04
118 0.04
119 0.04
120 0.05
121 0.05
122 0.05
123 0.06
124 0.08
125 0.08
126 0.08
127 0.08
128 0.09
129 0.09
130 0.08
131 0.07
132 0.08
133 0.08
134 0.09
135 0.1
136 0.1
137 0.11
138 0.15
139 0.21
140 0.25
141 0.3
142 0.33
143 0.41
144 0.51
145 0.59
146 0.62
147 0.65
148 0.69
149 0.72
150 0.8