Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0G0A1A0

Protein Details
Accession A0A0G0A1A0    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
34-53RPGIKKKPGIKKKQDVHVIEBasic
NLS Segment(s)
PositionSequence
36-46GIKKKPGIKKK
Subcellular Location(s) cyto 21, cyto_nucl 12.5, nucl 2, mito 2
Family & Domain DBs
Amino Acid Sequences MVTKFFMGMGIEDYPTKYEMGAGTFYRGDNLVDRPGIKKKPGIKKKQDVHVIEVFHSLKKQILWIWSLDVDKF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.12
4 0.09
5 0.1
6 0.09
7 0.11
8 0.13
9 0.12
10 0.13
11 0.14
12 0.14
13 0.13
14 0.13
15 0.12
16 0.11
17 0.12
18 0.12
19 0.12
20 0.13
21 0.15
22 0.2
23 0.22
24 0.21
25 0.25
26 0.31
27 0.41
28 0.51
29 0.59
30 0.63
31 0.71
32 0.76
33 0.8
34 0.8
35 0.72
36 0.68
37 0.62
38 0.53
39 0.44
40 0.42
41 0.34
42 0.26
43 0.24
44 0.19
45 0.17
46 0.16
47 0.18
48 0.16
49 0.19
50 0.2
51 0.2
52 0.23
53 0.24