Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F9X555

Protein Details
Accession A0A0F9X555   
Localization Confidence High
Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
27-48MTALCRKKTHAARKKLYVVTKRHydrophilic
NLS Segment(s)
PositionSequence
33-78KKTHAARKKLYVVTKRGKQEGLRAPKWILKEVRKEEEKTREKRRGA
116-118KRS
196-212KREPRKSLAAQAAGRRR
Subcellular Location(s) nucl 17, cyto_nucl 12.333, mito_nucl 9.833, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018744  DUF2293  
Pfam View protein in Pfam  
PF10056  DUF2293  
Amino Acid Sequences MEEERTVSPETPMPKGYGFLKKGNTFMTALCRKKTHAARKKLYVVTKRGKQEGLRAPKWILKEVRKEEEKTREKRRGAVQRRDAATEDAFEAATLKLFPDIPKQDLTTILKRTLRKRSGRVGRTGKLDLNKKAYLAVQAHARHCHTDYDRILARASQNRDAARRAIRDKVSKLLVEWGGDPTTVGSGGNLAPRNTKREPRKSLAAQAAGRRRSSFTEAVRHKHIPVLKQLPKQSRVPKAKEARPQPQSNIIDLTQDSEESEESGSTSQAFSEGERQDSEQDAGDGSYELSDVVDSDGDYEVDSDWLPE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.27
3 0.31
4 0.36
5 0.37
6 0.39
7 0.46
8 0.46
9 0.48
10 0.47
11 0.44
12 0.35
13 0.33
14 0.37
15 0.38
16 0.4
17 0.41
18 0.41
19 0.42
20 0.5
21 0.58
22 0.6
23 0.61
24 0.67
25 0.71
26 0.78
27 0.84
28 0.81
29 0.8
30 0.77
31 0.77
32 0.76
33 0.75
34 0.72
35 0.68
36 0.66
37 0.59
38 0.6
39 0.6
40 0.61
41 0.55
42 0.52
43 0.5
44 0.49
45 0.49
46 0.47
47 0.44
48 0.42
49 0.5
50 0.54
51 0.6
52 0.63
53 0.64
54 0.65
55 0.67
56 0.69
57 0.68
58 0.71
59 0.71
60 0.68
61 0.71
62 0.72
63 0.73
64 0.74
65 0.75
66 0.74
67 0.73
68 0.73
69 0.69
70 0.61
71 0.52
72 0.42
73 0.33
74 0.24
75 0.17
76 0.14
77 0.12
78 0.11
79 0.08
80 0.07
81 0.06
82 0.06
83 0.06
84 0.07
85 0.08
86 0.15
87 0.18
88 0.2
89 0.22
90 0.23
91 0.22
92 0.26
93 0.3
94 0.28
95 0.28
96 0.31
97 0.34
98 0.39
99 0.45
100 0.5
101 0.54
102 0.55
103 0.58
104 0.64
105 0.69
106 0.69
107 0.71
108 0.68
109 0.63
110 0.61
111 0.58
112 0.5
113 0.47
114 0.48
115 0.42
116 0.4
117 0.37
118 0.32
119 0.31
120 0.28
121 0.27
122 0.22
123 0.2
124 0.21
125 0.24
126 0.25
127 0.27
128 0.27
129 0.23
130 0.23
131 0.26
132 0.21
133 0.25
134 0.24
135 0.26
136 0.26
137 0.26
138 0.25
139 0.21
140 0.23
141 0.22
142 0.24
143 0.24
144 0.26
145 0.27
146 0.29
147 0.29
148 0.3
149 0.28
150 0.3
151 0.28
152 0.3
153 0.33
154 0.36
155 0.36
156 0.37
157 0.35
158 0.3
159 0.28
160 0.27
161 0.24
162 0.19
163 0.18
164 0.15
165 0.13
166 0.13
167 0.12
168 0.07
169 0.07
170 0.06
171 0.05
172 0.04
173 0.04
174 0.05
175 0.1
176 0.11
177 0.11
178 0.17
179 0.19
180 0.26
181 0.29
182 0.37
183 0.43
184 0.51
185 0.59
186 0.59
187 0.66
188 0.63
189 0.66
190 0.64
191 0.6
192 0.53
193 0.52
194 0.54
195 0.48
196 0.46
197 0.4
198 0.36
199 0.33
200 0.36
201 0.34
202 0.31
203 0.38
204 0.42
205 0.45
206 0.49
207 0.48
208 0.43
209 0.41
210 0.41
211 0.35
212 0.39
213 0.44
214 0.46
215 0.51
216 0.58
217 0.61
218 0.62
219 0.66
220 0.66
221 0.66
222 0.68
223 0.67
224 0.7
225 0.71
226 0.75
227 0.76
228 0.76
229 0.75
230 0.75
231 0.74
232 0.68
233 0.68
234 0.63
235 0.56
236 0.5
237 0.41
238 0.35
239 0.3
240 0.28
241 0.19
242 0.17
243 0.15
244 0.12
245 0.12
246 0.1
247 0.11
248 0.08
249 0.08
250 0.08
251 0.08
252 0.08
253 0.08
254 0.07
255 0.08
256 0.08
257 0.09
258 0.16
259 0.18
260 0.2
261 0.21
262 0.23
263 0.24
264 0.26
265 0.25
266 0.18
267 0.17
268 0.15
269 0.14
270 0.13
271 0.11
272 0.09
273 0.07
274 0.06
275 0.06
276 0.05
277 0.05
278 0.05
279 0.06
280 0.06
281 0.06
282 0.07
283 0.08
284 0.08
285 0.09
286 0.09
287 0.08
288 0.09