Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F9XGX8

Protein Details
Accession A0A0F9XGX8   
Localization Confidence High
Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
47-70VKAQGAYKKKSKRGIPNKLGAKRTHydrophilic
207-238TGLKTKAFRTRKQWFRHRRWRREREIAGQKEAHydrophilic
250-272KVMKAISKKAAKKAAKKAGKKAKBasic
NLS Segment(s)
PositionSequence
51-68GAYKKKSKRGIPNKLGAK
210-272KTKAFRTRKQWFRHRRWRREREIAGQKEAEKKRAESGGGGKVMKAISKKAAKKAAKKAGKKAK
Subcellular Location(s) mito 21.5, cyto_mito 12.5, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001684  Ribosomal_L27  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01016  Ribosomal_L27  
Amino Acid Sequences MRFFMVQRPILAAVTGIARPSLVNSAVAPLGAHLANVLVEGRRNASVKAQGAYKKKSKRGIPNKLGAKRTGDQFVIPGNILYKQRGTHWWPGENCIMGRDHTIHAMATGYVKYYRDPAKHPDRKYIGVVFNKEDTLPYPQHAERKRKLNKTVHTIRTEAAKAEVSPSGIPFEVTRVEAGEPDRLLRLRSDYSYREDNWRIGRLVKTTGLKTKAFRTRKQWFRHRRWRREREIAGQKEAEKKRAESGGGGKVMKAISKKAAKKAAKKAGKKAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.11
4 0.09
5 0.09
6 0.09
7 0.11
8 0.13
9 0.11
10 0.12
11 0.12
12 0.14
13 0.14
14 0.14
15 0.12
16 0.09
17 0.11
18 0.1
19 0.09
20 0.07
21 0.07
22 0.07
23 0.07
24 0.08
25 0.06
26 0.08
27 0.09
28 0.11
29 0.14
30 0.15
31 0.16
32 0.2
33 0.25
34 0.27
35 0.28
36 0.31
37 0.35
38 0.41
39 0.48
40 0.52
41 0.55
42 0.59
43 0.66
44 0.69
45 0.73
46 0.77
47 0.81
48 0.8
49 0.81
50 0.83
51 0.82
52 0.77
53 0.68
54 0.63
55 0.55
56 0.5
57 0.45
58 0.36
59 0.29
60 0.26
61 0.26
62 0.21
63 0.17
64 0.14
65 0.11
66 0.14
67 0.15
68 0.15
69 0.15
70 0.14
71 0.17
72 0.23
73 0.28
74 0.33
75 0.36
76 0.41
77 0.4
78 0.43
79 0.43
80 0.38
81 0.32
82 0.25
83 0.21
84 0.15
85 0.16
86 0.14
87 0.13
88 0.12
89 0.12
90 0.11
91 0.1
92 0.1
93 0.08
94 0.07
95 0.07
96 0.07
97 0.08
98 0.08
99 0.08
100 0.13
101 0.18
102 0.19
103 0.23
104 0.3
105 0.4
106 0.48
107 0.49
108 0.54
109 0.52
110 0.52
111 0.51
112 0.48
113 0.44
114 0.4
115 0.4
116 0.32
117 0.29
118 0.27
119 0.24
120 0.19
121 0.14
122 0.14
123 0.13
124 0.12
125 0.15
126 0.16
127 0.24
128 0.31
129 0.38
130 0.39
131 0.49
132 0.57
133 0.6
134 0.68
135 0.69
136 0.68
137 0.69
138 0.74
139 0.7
140 0.64
141 0.58
142 0.49
143 0.45
144 0.4
145 0.3
146 0.22
147 0.16
148 0.13
149 0.14
150 0.14
151 0.1
152 0.1
153 0.1
154 0.1
155 0.09
156 0.09
157 0.08
158 0.09
159 0.09
160 0.09
161 0.09
162 0.08
163 0.09
164 0.1
165 0.11
166 0.12
167 0.11
168 0.12
169 0.14
170 0.13
171 0.14
172 0.13
173 0.16
174 0.16
175 0.18
176 0.22
177 0.23
178 0.27
179 0.32
180 0.32
181 0.36
182 0.36
183 0.38
184 0.37
185 0.38
186 0.35
187 0.33
188 0.34
189 0.3
190 0.3
191 0.31
192 0.31
193 0.31
194 0.37
195 0.37
196 0.38
197 0.38
198 0.44
199 0.49
200 0.52
201 0.55
202 0.58
203 0.64
204 0.7
205 0.77
206 0.79
207 0.8
208 0.84
209 0.89
210 0.91
211 0.92
212 0.94
213 0.94
214 0.93
215 0.93
216 0.89
217 0.88
218 0.87
219 0.82
220 0.76
221 0.69
222 0.63
223 0.62
224 0.59
225 0.55
226 0.48
227 0.44
228 0.44
229 0.44
230 0.41
231 0.36
232 0.39
233 0.4
234 0.41
235 0.4
236 0.34
237 0.32
238 0.32
239 0.3
240 0.27
241 0.23
242 0.27
243 0.36
244 0.43
245 0.49
246 0.59
247 0.64
248 0.71
249 0.78
250 0.8
251 0.81
252 0.83