Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F9X1P3

Protein Details
Accession A0A0F9X1P3   
Localization Confidence Medium
Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MAKSSRSSSKKFNNQRKAASIFHydrophilic
78-105KKPNRPFSAKKGINKKRKKSSIVFPKYSHydrophilic
NLS Segment(s)
PositionSequence
78-119KKPNRPFSAKKGINKKRKKSSIVFPKYSDRLRKTARNAPKKA
Subcellular Location(s) nucl 18, cyto_nucl 10.5, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSSRSSSKKFNNQRKAASIFGPAETARQERLSAKLLELAKQAKPEPAEMKIDDGDNAPEKEEQAGADENSMDVDSKKPNRPFSAKKGINKKRKKSSIVFPKYSDRLRKTARNAPKKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.83
3 0.8
4 0.74
5 0.66
6 0.57
7 0.52
8 0.42
9 0.35
10 0.31
11 0.24
12 0.21
13 0.2
14 0.2
15 0.16
16 0.15
17 0.16
18 0.16
19 0.2
20 0.22
21 0.2
22 0.19
23 0.23
24 0.23
25 0.23
26 0.25
27 0.24
28 0.21
29 0.23
30 0.24
31 0.21
32 0.21
33 0.23
34 0.22
35 0.21
36 0.23
37 0.2
38 0.22
39 0.19
40 0.19
41 0.16
42 0.13
43 0.12
44 0.12
45 0.11
46 0.1
47 0.1
48 0.1
49 0.1
50 0.09
51 0.08
52 0.08
53 0.09
54 0.08
55 0.08
56 0.08
57 0.07
58 0.07
59 0.07
60 0.06
61 0.05
62 0.07
63 0.13
64 0.19
65 0.27
66 0.32
67 0.37
68 0.43
69 0.51
70 0.56
71 0.59
72 0.65
73 0.64
74 0.67
75 0.73
76 0.77
77 0.79
78 0.83
79 0.84
80 0.84
81 0.86
82 0.85
83 0.81
84 0.82
85 0.83
86 0.82
87 0.77
88 0.7
89 0.7
90 0.69
91 0.7
92 0.68
93 0.62
94 0.61
95 0.64
96 0.69
97 0.68
98 0.72
99 0.75