Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0F9X6B8

Protein Details
Accession A0A0F9X6B8    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
233-260GKATNGGPRKPGRPKKDKKAAPVVGKTLBasic
NLS Segment(s)
PositionSequence
231-262GNGKATNGGPRKPGRPKKDKKAAPVVGKTLRK
Subcellular Location(s) cyto 19, cyto_nucl 14.333, nucl 7.5, mito_nucl 4.666
Family & Domain DBs
Amino Acid Sequences MSDGIAPAVDKVGPPVPTAPEAQAGGPTMAMDTDTAKPETVNLPTFLEKPKEPPIIAETKAPEEAKPTEEPLSIADAFKLAHKTPRPVEVQSVPETPVNLATPVNGSPRPELNIPTEPAEPEKPQEEPVIITEAEEPLPTPTASAPGSDVGPDSIVDKPVTPNGESKPAELMAGALQPSAADAKSETSETATGEKRKADVAVATTTDEPAVEKEESEDSEPADKKAKIDNGNGKATNGGPRKPGRPKKDKKAAPVVGKTLRKTRSQGPVEI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.19
3 0.21
4 0.23
5 0.25
6 0.23
7 0.22
8 0.22
9 0.21
10 0.2
11 0.18
12 0.16
13 0.14
14 0.12
15 0.09
16 0.08
17 0.08
18 0.07
19 0.08
20 0.11
21 0.14
22 0.15
23 0.15
24 0.15
25 0.16
26 0.2
27 0.21
28 0.21
29 0.2
30 0.22
31 0.24
32 0.26
33 0.29
34 0.29
35 0.26
36 0.29
37 0.36
38 0.37
39 0.35
40 0.35
41 0.37
42 0.38
43 0.38
44 0.37
45 0.31
46 0.29
47 0.33
48 0.31
49 0.25
50 0.24
51 0.25
52 0.24
53 0.23
54 0.24
55 0.22
56 0.22
57 0.22
58 0.18
59 0.21
60 0.18
61 0.16
62 0.14
63 0.12
64 0.12
65 0.14
66 0.16
67 0.12
68 0.19
69 0.22
70 0.27
71 0.29
72 0.35
73 0.37
74 0.35
75 0.39
76 0.36
77 0.37
78 0.35
79 0.34
80 0.29
81 0.26
82 0.25
83 0.2
84 0.17
85 0.13
86 0.11
87 0.09
88 0.08
89 0.09
90 0.1
91 0.13
92 0.12
93 0.13
94 0.14
95 0.15
96 0.18
97 0.17
98 0.18
99 0.2
100 0.22
101 0.22
102 0.23
103 0.22
104 0.2
105 0.21
106 0.21
107 0.17
108 0.16
109 0.16
110 0.14
111 0.15
112 0.15
113 0.13
114 0.11
115 0.11
116 0.12
117 0.11
118 0.1
119 0.09
120 0.09
121 0.09
122 0.08
123 0.07
124 0.05
125 0.06
126 0.06
127 0.06
128 0.05
129 0.08
130 0.08
131 0.08
132 0.08
133 0.08
134 0.08
135 0.08
136 0.08
137 0.06
138 0.06
139 0.06
140 0.06
141 0.06
142 0.08
143 0.08
144 0.08
145 0.09
146 0.11
147 0.13
148 0.13
149 0.15
150 0.16
151 0.24
152 0.24
153 0.24
154 0.23
155 0.22
156 0.21
157 0.17
158 0.16
159 0.08
160 0.09
161 0.08
162 0.06
163 0.05
164 0.05
165 0.06
166 0.06
167 0.05
168 0.04
169 0.05
170 0.07
171 0.08
172 0.09
173 0.09
174 0.09
175 0.1
176 0.11
177 0.15
178 0.18
179 0.2
180 0.21
181 0.22
182 0.22
183 0.22
184 0.22
185 0.19
186 0.16
187 0.16
188 0.17
189 0.16
190 0.17
191 0.16
192 0.16
193 0.15
194 0.12
195 0.1
196 0.08
197 0.11
198 0.1
199 0.1
200 0.11
201 0.13
202 0.15
203 0.17
204 0.17
205 0.14
206 0.21
207 0.22
208 0.22
209 0.27
210 0.26
211 0.25
212 0.32
213 0.38
214 0.36
215 0.44
216 0.53
217 0.52
218 0.59
219 0.58
220 0.51
221 0.45
222 0.42
223 0.42
224 0.37
225 0.34
226 0.34
227 0.39
228 0.48
229 0.57
230 0.65
231 0.67
232 0.73
233 0.81
234 0.85
235 0.9
236 0.89
237 0.87
238 0.88
239 0.86
240 0.85
241 0.81
242 0.78
243 0.76
244 0.75
245 0.7
246 0.67
247 0.63
248 0.6
249 0.58
250 0.58
251 0.6