Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F9WWL3

Protein Details
Accession A0A0F9WWL3   
Localization Confidence Medium
Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
44-76SSMVRKAYKGGHRRKQQRRRRQSKPATRNLGGCHydrophilic
NLS Segment(s)
PositionSequence
48-68RKAYKGGHRRKQQRRRRQSKP
Subcellular Location(s) nucl 16, cyto_nucl 12.5, cyto 7, mito 3
Family & Domain DBs
Amino Acid Sequences MVLSNRVDALEQQVAAQAAANVFVDDPMAIVPSTDPVPVNTAASSMVRKAYKGGHRRKQQRRRRQSKPATRNLGGCLAH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.15
3 0.15
4 0.1
5 0.07
6 0.08
7 0.08
8 0.06
9 0.05
10 0.05
11 0.05
12 0.04
13 0.04
14 0.04
15 0.04
16 0.04
17 0.04
18 0.04
19 0.05
20 0.06
21 0.07
22 0.07
23 0.06
24 0.09
25 0.09
26 0.1
27 0.08
28 0.08
29 0.08
30 0.09
31 0.09
32 0.07
33 0.11
34 0.11
35 0.11
36 0.13
37 0.19
38 0.27
39 0.37
40 0.47
41 0.52
42 0.62
43 0.73
44 0.82
45 0.86
46 0.89
47 0.9
48 0.91
49 0.92
50 0.92
51 0.93
52 0.93
53 0.93
54 0.93
55 0.92
56 0.9
57 0.83
58 0.76
59 0.69